Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507CWA0

Protein Details
Accession A0A507CWA0    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
77-98GTTAPQQPPRQQPPRQQPPPSKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, cyto 5.5, pero 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007834  DSS1_SEM1  
Gene Ontology GO:0005634  C:nucleus  
GO:0008541  C:proteasome regulatory particle, lid subcomplex  
GO:0000724  P:double-strand break repair via homologous recombination  
GO:0006406  P:mRNA export from nucleus  
GO:0043248  P:proteasome assembly  
Pfam View protein in Pfam  
PF05160  DSS1_SEM1  
Amino Acid Sequences MASNQYQQLPKLGPIEEDDEFEDFDREDWPEAEEDHTDVQCWIVNWDDTDVDDDFTRQLRAELSKPAAQVPTNPPSGTTAPQQPPRQQPPRQQPPPSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.23
4 0.22
5 0.21
6 0.18
7 0.18
8 0.17
9 0.15
10 0.1
11 0.1
12 0.1
13 0.09
14 0.1
15 0.1
16 0.1
17 0.1
18 0.11
19 0.12
20 0.11
21 0.11
22 0.12
23 0.11
24 0.11
25 0.1
26 0.1
27 0.09
28 0.08
29 0.08
30 0.07
31 0.07
32 0.07
33 0.08
34 0.08
35 0.07
36 0.09
37 0.08
38 0.08
39 0.07
40 0.07
41 0.07
42 0.08
43 0.08
44 0.06
45 0.07
46 0.08
47 0.11
48 0.13
49 0.17
50 0.2
51 0.22
52 0.22
53 0.24
54 0.24
55 0.21
56 0.24
57 0.26
58 0.27
59 0.27
60 0.26
61 0.25
62 0.27
63 0.3
64 0.27
65 0.26
66 0.3
67 0.35
68 0.44
69 0.49
70 0.53
71 0.6
72 0.68
73 0.73
74 0.72
75 0.75
76 0.78
77 0.83
78 0.85