Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507BST7

Protein Details
Accession A0A507BST7    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
1-25RAYYSTKRYKRKRWDADKAKRGELDBasic
78-97RPTYLKPPSKDKNTPMKRKAHydrophilic
NLS Segment(s)
PositionSequence
10-14KRKRW
88-114DKNTPMKRKADEGGTSRAGPSKSRKTR
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences RAYYSTKRYKRKRWDADKAKRGELDRVLEGIVKMVGESMGHKLSGGKQVIVAIGMGDFSSNKSRHVMFIRGYLEHDERPTYLKPPSKDKNTPMKRKADEGGTSRAGPSKSRKTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.94
3 0.95
4 0.93
5 0.87
6 0.8
7 0.74
8 0.65
9 0.6
10 0.54
11 0.47
12 0.39
13 0.34
14 0.29
15 0.26
16 0.23
17 0.18
18 0.13
19 0.08
20 0.06
21 0.06
22 0.05
23 0.04
24 0.06
25 0.08
26 0.08
27 0.08
28 0.08
29 0.09
30 0.12
31 0.18
32 0.18
33 0.15
34 0.15
35 0.15
36 0.15
37 0.14
38 0.12
39 0.05
40 0.04
41 0.04
42 0.03
43 0.03
44 0.03
45 0.04
46 0.1
47 0.1
48 0.11
49 0.13
50 0.14
51 0.18
52 0.21
53 0.23
54 0.19
55 0.24
56 0.25
57 0.24
58 0.25
59 0.25
60 0.24
61 0.21
62 0.21
63 0.17
64 0.15
65 0.19
66 0.19
67 0.18
68 0.22
69 0.27
70 0.29
71 0.38
72 0.46
73 0.52
74 0.58
75 0.63
76 0.68
77 0.73
78 0.8
79 0.79
80 0.8
81 0.74
82 0.72
83 0.68
84 0.64
85 0.6
86 0.54
87 0.53
88 0.46
89 0.44
90 0.39
91 0.4
92 0.34
93 0.32
94 0.37