Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507DF36

Protein Details
Accession A0A507DF36   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
100-127IPSLWSSHKHAPHKKHRIRPVKPSNTDIHydrophilic
NLS Segment(s)
PositionSequence
110-119APHKKHRIRP
Subcellular Location(s) cyto_nucl 6, mito 16, nucl 8.5
Family & Domain DBs
Amino Acid Sequences MTYPIFIDAKSLIIKRTYKLVYAWPSSIMDMSTLLWKSCLTPDSNVVSTGSYASLLLYAWNPPPLASLRIFPPESPSYTPCRTPTREMSHPNVTETASFIPSLWSSHKHAPHKKHRIRPVKPSNTDIEAHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.33
4 0.32
5 0.29
6 0.3
7 0.36
8 0.37
9 0.38
10 0.38
11 0.32
12 0.31
13 0.3
14 0.28
15 0.2
16 0.14
17 0.1
18 0.1
19 0.12
20 0.12
21 0.11
22 0.11
23 0.11
24 0.12
25 0.14
26 0.16
27 0.13
28 0.14
29 0.19
30 0.23
31 0.23
32 0.22
33 0.2
34 0.18
35 0.16
36 0.15
37 0.11
38 0.07
39 0.06
40 0.05
41 0.05
42 0.04
43 0.05
44 0.05
45 0.06
46 0.06
47 0.07
48 0.07
49 0.07
50 0.09
51 0.09
52 0.11
53 0.11
54 0.11
55 0.12
56 0.16
57 0.17
58 0.15
59 0.2
60 0.19
61 0.21
62 0.22
63 0.23
64 0.25
65 0.27
66 0.3
67 0.29
68 0.34
69 0.35
70 0.38
71 0.44
72 0.45
73 0.51
74 0.53
75 0.55
76 0.57
77 0.54
78 0.5
79 0.43
80 0.36
81 0.28
82 0.25
83 0.2
84 0.13
85 0.13
86 0.11
87 0.11
88 0.11
89 0.13
90 0.14
91 0.16
92 0.21
93 0.28
94 0.36
95 0.45
96 0.53
97 0.61
98 0.7
99 0.78
100 0.82
101 0.85
102 0.88
103 0.89
104 0.88
105 0.89
106 0.89
107 0.88
108 0.84
109 0.79
110 0.75
111 0.68