Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507DNJ5

Protein Details
Accession A0A507DNJ5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-80KSLWVKSQKVKTEKKTKNIDIHVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 4, mito 21
Family & Domain DBs
Amino Acid Sequences MPRASGCANIKGHHVAHYILSLAAPPESSQVYRLPKQTTEKPSPVSFRNNNIIYLYIKSLWVKSQKVKTEKKTKNIDIHVAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.23
3 0.22
4 0.21
5 0.18
6 0.14
7 0.13
8 0.09
9 0.08
10 0.07
11 0.06
12 0.06
13 0.07
14 0.08
15 0.08
16 0.1
17 0.14
18 0.2
19 0.23
20 0.27
21 0.27
22 0.3
23 0.36
24 0.42
25 0.44
26 0.45
27 0.45
28 0.44
29 0.44
30 0.44
31 0.42
32 0.42
33 0.37
34 0.36
35 0.41
36 0.38
37 0.37
38 0.34
39 0.32
40 0.25
41 0.24
42 0.21
43 0.14
44 0.14
45 0.14
46 0.15
47 0.18
48 0.23
49 0.26
50 0.32
51 0.4
52 0.48
53 0.57
54 0.65
55 0.7
56 0.75
57 0.79
58 0.81
59 0.83
60 0.82
61 0.83
62 0.79