Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507CHS2

Protein Details
Accession A0A507CHS2    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
98-119ALYPPKRSPYRGRRQRPPSTYQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0008270  F:zinc ion binding  
GO:0006355  P:regulation of DNA-templated transcription  
Amino Acid Sequences MDHRPDSVATCQTHTLRSPYAAISNDHVTQDKVMRVREITDQDPIPPLVVDESRWECNYCGSKTTTLKRQGPQEYQQLCNPCASKWSRGKILPQYPKALYPPKRSPYRGRRQRPPSTYQAYQSPAHTPDNSSSACLVEHAGSSHLIESQQRKSIVSPAPVDDVDARRIYLAEKLKLAQEAQIMDIYQALSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.3
4 0.31
5 0.3
6 0.26
7 0.29
8 0.28
9 0.27
10 0.26
11 0.28
12 0.27
13 0.27
14 0.26
15 0.22
16 0.22
17 0.24
18 0.24
19 0.24
20 0.24
21 0.25
22 0.25
23 0.26
24 0.3
25 0.31
26 0.28
27 0.29
28 0.28
29 0.27
30 0.28
31 0.26
32 0.2
33 0.15
34 0.14
35 0.11
36 0.11
37 0.11
38 0.14
39 0.18
40 0.2
41 0.21
42 0.22
43 0.19
44 0.25
45 0.29
46 0.25
47 0.24
48 0.24
49 0.29
50 0.34
51 0.4
52 0.42
53 0.46
54 0.51
55 0.52
56 0.57
57 0.58
58 0.58
59 0.57
60 0.58
61 0.53
62 0.49
63 0.49
64 0.44
65 0.38
66 0.35
67 0.3
68 0.21
69 0.23
70 0.23
71 0.28
72 0.31
73 0.34
74 0.36
75 0.37
76 0.43
77 0.46
78 0.53
79 0.53
80 0.49
81 0.49
82 0.44
83 0.44
84 0.43
85 0.43
86 0.4
87 0.4
88 0.46
89 0.49
90 0.54
91 0.57
92 0.64
93 0.66
94 0.71
95 0.73
96 0.74
97 0.77
98 0.8
99 0.86
100 0.82
101 0.77
102 0.74
103 0.7
104 0.63
105 0.56
106 0.5
107 0.45
108 0.4
109 0.35
110 0.31
111 0.27
112 0.27
113 0.25
114 0.22
115 0.2
116 0.23
117 0.22
118 0.19
119 0.17
120 0.14
121 0.14
122 0.13
123 0.12
124 0.08
125 0.08
126 0.08
127 0.08
128 0.08
129 0.09
130 0.08
131 0.08
132 0.09
133 0.13
134 0.17
135 0.2
136 0.25
137 0.26
138 0.26
139 0.27
140 0.34
141 0.35
142 0.35
143 0.33
144 0.3
145 0.32
146 0.31
147 0.32
148 0.28
149 0.26
150 0.25
151 0.23
152 0.21
153 0.18
154 0.18
155 0.18
156 0.21
157 0.25
158 0.24
159 0.25
160 0.27
161 0.29
162 0.31
163 0.3
164 0.26
165 0.23
166 0.21
167 0.2
168 0.21
169 0.18
170 0.16
171 0.17
172 0.14