Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507CLL8

Protein Details
Accession A0A507CLL8    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
161-188RLCKDCSHKLNYRKNKERAKRDRVEARNBasic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_mito 5, mito 4.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019129  Folate-sensitive_fs_Fra10Ac1  
Pfam View protein in Pfam  
PF09725  Fra10Ac1  
Amino Acid Sequences MKDSEYDIRCLRKAPCVACSSDNPVSKLKHKALVRDYINFYGHGKPISKTQTLQATDLDVLQQHHKFVRNDEDNEESTWEQRVAKRYYDRLLKEYALVDLSRYKQGKLGLRWRTQKEVFAGKGQFVCGSIACDSNYNLSAWEVPFAYKEDGTQKYELVKLRLCKDCSHKLNYRKNKERAKRDRVEARNASSGDNHGITENSDSNIVNLKTPSPGEASTDKKRGRGDEDDGFEQAKVKYSKADTTSSTPAAEASNIWSAPVQLEEEKSRGEDMDAFLSELFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.44
4 0.47
5 0.47
6 0.48
7 0.47
8 0.48
9 0.48
10 0.44
11 0.46
12 0.46
13 0.48
14 0.53
15 0.49
16 0.49
17 0.48
18 0.54
19 0.55
20 0.6
21 0.58
22 0.56
23 0.56
24 0.53
25 0.51
26 0.43
27 0.39
28 0.34
29 0.32
30 0.29
31 0.26
32 0.22
33 0.29
34 0.34
35 0.34
36 0.31
37 0.34
38 0.39
39 0.4
40 0.4
41 0.33
42 0.3
43 0.27
44 0.26
45 0.21
46 0.14
47 0.14
48 0.18
49 0.18
50 0.17
51 0.21
52 0.27
53 0.28
54 0.3
55 0.39
56 0.4
57 0.41
58 0.43
59 0.44
60 0.39
61 0.38
62 0.37
63 0.27
64 0.22
65 0.2
66 0.18
67 0.16
68 0.18
69 0.25
70 0.25
71 0.31
72 0.35
73 0.38
74 0.43
75 0.48
76 0.48
77 0.43
78 0.44
79 0.38
80 0.34
81 0.31
82 0.25
83 0.18
84 0.15
85 0.13
86 0.14
87 0.15
88 0.2
89 0.2
90 0.19
91 0.21
92 0.26
93 0.32
94 0.36
95 0.43
96 0.45
97 0.52
98 0.59
99 0.59
100 0.61
101 0.56
102 0.52
103 0.47
104 0.44
105 0.38
106 0.35
107 0.33
108 0.27
109 0.27
110 0.23
111 0.2
112 0.14
113 0.13
114 0.08
115 0.09
116 0.08
117 0.09
118 0.09
119 0.09
120 0.09
121 0.1
122 0.1
123 0.09
124 0.08
125 0.07
126 0.08
127 0.07
128 0.08
129 0.07
130 0.06
131 0.07
132 0.09
133 0.09
134 0.08
135 0.09
136 0.14
137 0.17
138 0.19
139 0.19
140 0.18
141 0.19
142 0.23
143 0.24
144 0.21
145 0.21
146 0.23
147 0.28
148 0.33
149 0.33
150 0.34
151 0.39
152 0.46
153 0.47
154 0.51
155 0.53
156 0.57
157 0.66
158 0.72
159 0.76
160 0.76
161 0.81
162 0.84
163 0.85
164 0.86
165 0.86
166 0.86
167 0.82
168 0.81
169 0.82
170 0.77
171 0.77
172 0.7
173 0.64
174 0.59
175 0.53
176 0.46
177 0.36
178 0.33
179 0.26
180 0.21
181 0.18
182 0.12
183 0.12
184 0.11
185 0.13
186 0.13
187 0.11
188 0.11
189 0.11
190 0.11
191 0.17
192 0.17
193 0.15
194 0.15
195 0.15
196 0.16
197 0.17
198 0.18
199 0.15
200 0.15
201 0.17
202 0.22
203 0.28
204 0.33
205 0.42
206 0.42
207 0.44
208 0.47
209 0.47
210 0.48
211 0.47
212 0.46
213 0.45
214 0.48
215 0.46
216 0.43
217 0.4
218 0.33
219 0.3
220 0.24
221 0.24
222 0.2
223 0.19
224 0.23
225 0.25
226 0.32
227 0.33
228 0.36
229 0.33
230 0.38
231 0.43
232 0.39
233 0.36
234 0.29
235 0.27
236 0.24
237 0.2
238 0.15
239 0.13
240 0.16
241 0.15
242 0.16
243 0.15
244 0.15
245 0.15
246 0.16
247 0.15
248 0.13
249 0.17
250 0.2
251 0.21
252 0.22
253 0.22
254 0.22
255 0.2
256 0.19
257 0.19
258 0.18
259 0.21
260 0.21
261 0.2