Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507DP00

Protein Details
Accession A0A507DP00    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
139-160EDLRAPYKPRRHQVTKTSHPVSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002680  AOX  
IPR038659  AOX_sf  
Gene Ontology GO:0043229  C:intracellular organelle  
GO:0070469  C:respirasome  
GO:0009916  F:alternative oxidase activity  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01786  AOX  
Amino Acid Sequences MRHDGGWIDHLLKEASNERMHLMIWMKVCHPSVLERALVAITQYGFTAVFSLMYVCTPSVAHRFVGYLEEEAVISYTHFLHAIDAGAIENTPAPPIAIDYYNLSDDARLRDVVLCVRADEANHRDVNHYFGDRIVAGTEDLRAPYKPRRHQVTKTSHPVSKDIADVKRVDVTISP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.22
4 0.22
5 0.22
6 0.22
7 0.22
8 0.22
9 0.21
10 0.19
11 0.2
12 0.2
13 0.2
14 0.24
15 0.24
16 0.21
17 0.2
18 0.2
19 0.22
20 0.23
21 0.22
22 0.17
23 0.17
24 0.17
25 0.15
26 0.12
27 0.09
28 0.07
29 0.07
30 0.07
31 0.06
32 0.06
33 0.06
34 0.07
35 0.06
36 0.05
37 0.05
38 0.06
39 0.05
40 0.06
41 0.06
42 0.05
43 0.06
44 0.06
45 0.08
46 0.11
47 0.12
48 0.13
49 0.12
50 0.13
51 0.13
52 0.14
53 0.13
54 0.09
55 0.08
56 0.08
57 0.08
58 0.07
59 0.07
60 0.06
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.05
84 0.06
85 0.06
86 0.08
87 0.09
88 0.1
89 0.1
90 0.09
91 0.09
92 0.1
93 0.11
94 0.11
95 0.1
96 0.1
97 0.11
98 0.12
99 0.14
100 0.14
101 0.12
102 0.11
103 0.12
104 0.12
105 0.11
106 0.16
107 0.17
108 0.2
109 0.21
110 0.21
111 0.22
112 0.22
113 0.25
114 0.22
115 0.21
116 0.16
117 0.15
118 0.17
119 0.14
120 0.14
121 0.11
122 0.09
123 0.08
124 0.08
125 0.09
126 0.09
127 0.1
128 0.11
129 0.11
130 0.15
131 0.24
132 0.33
133 0.41
134 0.5
135 0.59
136 0.66
137 0.74
138 0.8
139 0.81
140 0.82
141 0.82
142 0.79
143 0.73
144 0.66
145 0.61
146 0.55
147 0.46
148 0.42
149 0.39
150 0.36
151 0.38
152 0.36
153 0.36
154 0.36
155 0.33