Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507DLP2

Protein Details
Accession A0A507DLP2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-83TFNLRKKADKKKQKEGVKDIBasic
NLS Segment(s)
PositionSequence
69-77KKADKKKQK
Subcellular Location(s) E.R. 4, extr 14, plas 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001104  3-oxo-5_a-steroid_4-DH_C  
IPR039357  SRD5A/TECR  
Gene Ontology GO:0016020  C:membrane  
GO:0016627  F:oxidoreductase activity, acting on the CH-CH group of donors  
GO:0006629  P:lipid metabolic process  
Pfam View protein in Pfam  
PF02544  Steroid_dh  
PROSITE View protein in PROSITE  
PS50244  S5A_REDUCTASE  
Amino Acid Sequences MAPQSVVVVLSAVAFNLANGYLNGRALGALSMHDATYITSPRFLIGAAIYFIGMYINISSDYATFNLRKKADKKKQKEGVKDINSLPPNEKYVIPRGGLFELVSCPAYFGEIVEWLGAEGSHGAQMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.06
5 0.06
6 0.06
7 0.08
8 0.08
9 0.09
10 0.09
11 0.08
12 0.08
13 0.08
14 0.08
15 0.06
16 0.05
17 0.07
18 0.07
19 0.07
20 0.07
21 0.07
22 0.07
23 0.1
24 0.11
25 0.1
26 0.11
27 0.11
28 0.11
29 0.11
30 0.1
31 0.08
32 0.06
33 0.07
34 0.06
35 0.06
36 0.06
37 0.05
38 0.05
39 0.05
40 0.04
41 0.03
42 0.03
43 0.03
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.06
50 0.08
51 0.09
52 0.11
53 0.17
54 0.18
55 0.23
56 0.29
57 0.4
58 0.49
59 0.58
60 0.63
61 0.69
62 0.77
63 0.79
64 0.81
65 0.79
66 0.79
67 0.73
68 0.69
69 0.6
70 0.58
71 0.52
72 0.45
73 0.39
74 0.31
75 0.28
76 0.26
77 0.26
78 0.22
79 0.26
80 0.28
81 0.26
82 0.25
83 0.25
84 0.24
85 0.23
86 0.2
87 0.15
88 0.13
89 0.13
90 0.13
91 0.1
92 0.1
93 0.09
94 0.1
95 0.09
96 0.08
97 0.08
98 0.09
99 0.09
100 0.08
101 0.08
102 0.07
103 0.07
104 0.07
105 0.06
106 0.05
107 0.06