Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507DA37

Protein Details
Accession A0A507DA37   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
67-87GSGPRRPPRAQVCRKPRTQLTHydrophilic
89-117NTSLNRSRPATRRQRRQPRARATTSRRAGHydrophilic
NLS Segment(s)
PositionSequence
94-121RSRPATRRQRRQPRARATTSRRAGRRSQ
Subcellular Location(s) cyto 5.5, cyto_nucl 5.5, mito 17, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MSAKATSQLRTRTVIAPRPGWVRRNRRLVRIDDAEDTRVVEERQRHAVPPIGALGDHEIVHTGDSAGSGPRRPPRAQVCRKPRTQLTGNTSLNRSRPATRRQRRQPRARATTSRRAGRRSQPPTPQPEPRQPQPPTPPRDTPVPPAPPAFIVPDPTDLDFHYPDDGTDAGDAPYVHIQPDVAQYMRLPTGLRQERDRFVVQLVVALGPRASADAQLLMAFIVDRCLIIDTPQGPDELANIVVGAAAVALAYDDSFLEVVPLLAEITGLGRALVARLQRVVLSAIGYRVTLWWCVLSHEVSERSLLVPAGGPQGDLAAAAMQFVQYVGIIMYISLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.52
3 0.49
4 0.5
5 0.55
6 0.57
7 0.59
8 0.61
9 0.63
10 0.66
11 0.75
12 0.75
13 0.76
14 0.78
15 0.75
16 0.74
17 0.7
18 0.65
19 0.59
20 0.56
21 0.49
22 0.42
23 0.37
24 0.29
25 0.24
26 0.21
27 0.2
28 0.23
29 0.25
30 0.33
31 0.34
32 0.34
33 0.35
34 0.41
35 0.36
36 0.32
37 0.3
38 0.22
39 0.2
40 0.2
41 0.2
42 0.15
43 0.14
44 0.12
45 0.11
46 0.11
47 0.11
48 0.11
49 0.08
50 0.06
51 0.06
52 0.07
53 0.09
54 0.11
55 0.12
56 0.18
57 0.24
58 0.3
59 0.31
60 0.39
61 0.46
62 0.56
63 0.65
64 0.7
65 0.75
66 0.78
67 0.82
68 0.81
69 0.75
70 0.72
71 0.68
72 0.66
73 0.63
74 0.64
75 0.62
76 0.58
77 0.56
78 0.51
79 0.46
80 0.41
81 0.36
82 0.33
83 0.37
84 0.44
85 0.53
86 0.59
87 0.69
88 0.76
89 0.84
90 0.88
91 0.91
92 0.92
93 0.91
94 0.9
95 0.87
96 0.86
97 0.83
98 0.83
99 0.8
100 0.77
101 0.7
102 0.65
103 0.64
104 0.63
105 0.66
106 0.63
107 0.63
108 0.64
109 0.67
110 0.7
111 0.69
112 0.69
113 0.64
114 0.67
115 0.66
116 0.62
117 0.65
118 0.58
119 0.6
120 0.62
121 0.65
122 0.61
123 0.61
124 0.59
125 0.52
126 0.56
127 0.51
128 0.46
129 0.46
130 0.43
131 0.38
132 0.35
133 0.34
134 0.28
135 0.26
136 0.23
137 0.15
138 0.14
139 0.13
140 0.15
141 0.15
142 0.15
143 0.14
144 0.12
145 0.14
146 0.12
147 0.12
148 0.1
149 0.09
150 0.08
151 0.09
152 0.09
153 0.06
154 0.06
155 0.06
156 0.05
157 0.06
158 0.06
159 0.06
160 0.07
161 0.07
162 0.07
163 0.07
164 0.07
165 0.07
166 0.09
167 0.1
168 0.08
169 0.08
170 0.08
171 0.1
172 0.1
173 0.1
174 0.08
175 0.08
176 0.18
177 0.23
178 0.25
179 0.29
180 0.32
181 0.34
182 0.38
183 0.37
184 0.28
185 0.24
186 0.24
187 0.18
188 0.16
189 0.14
190 0.1
191 0.09
192 0.08
193 0.08
194 0.05
195 0.06
196 0.05
197 0.05
198 0.04
199 0.05
200 0.05
201 0.06
202 0.06
203 0.06
204 0.05
205 0.04
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.06
213 0.06
214 0.07
215 0.11
216 0.1
217 0.13
218 0.13
219 0.13
220 0.12
221 0.12
222 0.12
223 0.1
224 0.09
225 0.06
226 0.06
227 0.05
228 0.05
229 0.05
230 0.04
231 0.02
232 0.02
233 0.02
234 0.02
235 0.02
236 0.02
237 0.02
238 0.02
239 0.03
240 0.03
241 0.04
242 0.04
243 0.04
244 0.04
245 0.04
246 0.04
247 0.04
248 0.04
249 0.04
250 0.04
251 0.03
252 0.04
253 0.04
254 0.04
255 0.04
256 0.04
257 0.04
258 0.05
259 0.08
260 0.09
261 0.1
262 0.11
263 0.12
264 0.12
265 0.13
266 0.14
267 0.12
268 0.12
269 0.12
270 0.12
271 0.12
272 0.12
273 0.11
274 0.12
275 0.12
276 0.12
277 0.11
278 0.12
279 0.12
280 0.15
281 0.17
282 0.16
283 0.16
284 0.21
285 0.22
286 0.2
287 0.21
288 0.2
289 0.18
290 0.18
291 0.16
292 0.12
293 0.11
294 0.12
295 0.16
296 0.15
297 0.14
298 0.12
299 0.13
300 0.12
301 0.11
302 0.09
303 0.06
304 0.06
305 0.06
306 0.06
307 0.06
308 0.06
309 0.06
310 0.06
311 0.04
312 0.05
313 0.05
314 0.05
315 0.05