Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507D3P2

Protein Details
Accession A0A507D3P2    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
80-122PLDLRPKKTRAIRRRLTKEEAGKKTLRQQKKLQHFPLRKYAIKHydrophilic
NLS Segment(s)
PositionSequence
83-111LRPKKTRAIRRRLTKEEAGKKTLRQQKKL
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAKVKTIELRNKTKAELTKQLDELKQELASLRVQKVAGGNASKLAKIKDVRKSIARVKTVITQTQRDQLRLYYKGKKYIPLDLRPKKTRAIRRRLTKEEAGKKTLRQQKKLQHFPLRKYAIKAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.56
3 0.57
4 0.54
5 0.53
6 0.55
7 0.58
8 0.52
9 0.48
10 0.42
11 0.34
12 0.28
13 0.22
14 0.19
15 0.16
16 0.18
17 0.19
18 0.18
19 0.19
20 0.18
21 0.19
22 0.2
23 0.2
24 0.19
25 0.17
26 0.16
27 0.18
28 0.19
29 0.18
30 0.18
31 0.17
32 0.19
33 0.22
34 0.29
35 0.33
36 0.37
37 0.39
38 0.42
39 0.46
40 0.48
41 0.51
42 0.46
43 0.39
44 0.36
45 0.39
46 0.37
47 0.37
48 0.32
49 0.28
50 0.27
51 0.33
52 0.32
53 0.27
54 0.26
55 0.24
56 0.26
57 0.28
58 0.32
59 0.34
60 0.36
61 0.43
62 0.43
63 0.47
64 0.43
65 0.48
66 0.5
67 0.5
68 0.58
69 0.59
70 0.67
71 0.65
72 0.66
73 0.63
74 0.65
75 0.67
76 0.67
77 0.69
78 0.7
79 0.76
80 0.83
81 0.83
82 0.81
83 0.78
84 0.78
85 0.78
86 0.74
87 0.69
88 0.62
89 0.59
90 0.62
91 0.63
92 0.62
93 0.59
94 0.63
95 0.67
96 0.76
97 0.83
98 0.83
99 0.84
100 0.83
101 0.82
102 0.83
103 0.81
104 0.74