Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507CNX6

Protein Details
Accession A0A507CNX6    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
14-41ASASAGGKNKKKKWSKGKVKDQANNAVVHydrophilic
NLS Segment(s)
PositionSequence
10-32AQKAASASAGGKNKKKKWSKGKV
116-129AKGGKGPKAVPKKK
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAQEKTKAQKAASASAGGKNKKKKWSKGKVKDQANNAVVFDKTSYEKLYKEVPTYKLITPSVLVDRLRINGSLARIALRELEQKEMIKLVSAHGSQLIYTRATKEEAADEAAGAKGGKGPKAVPKKKADEEAAAAPDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.35
4 0.34
5 0.41
6 0.43
7 0.47
8 0.5
9 0.55
10 0.61
11 0.69
12 0.73
13 0.77
14 0.82
15 0.86
16 0.87
17 0.92
18 0.91
19 0.92
20 0.87
21 0.82
22 0.8
23 0.71
24 0.61
25 0.5
26 0.42
27 0.32
28 0.26
29 0.2
30 0.13
31 0.12
32 0.12
33 0.14
34 0.14
35 0.15
36 0.16
37 0.22
38 0.22
39 0.25
40 0.28
41 0.28
42 0.3
43 0.33
44 0.32
45 0.31
46 0.29
47 0.25
48 0.2
49 0.19
50 0.17
51 0.17
52 0.16
53 0.13
54 0.13
55 0.14
56 0.15
57 0.13
58 0.12
59 0.11
60 0.11
61 0.11
62 0.1
63 0.1
64 0.09
65 0.09
66 0.09
67 0.09
68 0.13
69 0.13
70 0.15
71 0.17
72 0.17
73 0.17
74 0.17
75 0.16
76 0.12
77 0.11
78 0.1
79 0.12
80 0.12
81 0.12
82 0.12
83 0.12
84 0.11
85 0.13
86 0.13
87 0.11
88 0.11
89 0.13
90 0.13
91 0.15
92 0.15
93 0.15
94 0.15
95 0.15
96 0.16
97 0.15
98 0.13
99 0.12
100 0.12
101 0.11
102 0.09
103 0.07
104 0.09
105 0.11
106 0.13
107 0.14
108 0.16
109 0.25
110 0.37
111 0.44
112 0.49
113 0.56
114 0.64
115 0.69
116 0.74
117 0.69
118 0.63
119 0.6
120 0.57
121 0.5