Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507DTB2

Protein Details
Accession A0A507DTB2    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
88-109YYSTTKYKRKVWHADKAKRGELHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 11, cyto 2
Family & Domain DBs
Amino Acid Sequences MKNPSKSRQLDEVFLLPLKMLAKSRYVLDNCQRRYVRTPSFKINGLVLSIDTTSKPPPVDRKVEDGINLPNIFSNKRFVRSHDIAHTYYSTTKYKRKVWHADKAKRGELDRVLTKSWSIIASMCKEIRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.3
3 0.21
4 0.19
5 0.16
6 0.15
7 0.15
8 0.14
9 0.17
10 0.18
11 0.21
12 0.26
13 0.28
14 0.33
15 0.39
16 0.47
17 0.47
18 0.54
19 0.53
20 0.49
21 0.53
22 0.54
23 0.55
24 0.54
25 0.56
26 0.54
27 0.57
28 0.55
29 0.5
30 0.43
31 0.34
32 0.25
33 0.21
34 0.14
35 0.11
36 0.09
37 0.08
38 0.07
39 0.08
40 0.08
41 0.1
42 0.1
43 0.12
44 0.19
45 0.24
46 0.3
47 0.3
48 0.35
49 0.35
50 0.35
51 0.34
52 0.28
53 0.24
54 0.22
55 0.2
56 0.14
57 0.13
58 0.13
59 0.14
60 0.12
61 0.18
62 0.16
63 0.22
64 0.23
65 0.26
66 0.34
67 0.36
68 0.39
69 0.38
70 0.41
71 0.36
72 0.37
73 0.33
74 0.26
75 0.25
76 0.25
77 0.24
78 0.25
79 0.31
80 0.36
81 0.43
82 0.5
83 0.57
84 0.65
85 0.68
86 0.74
87 0.78
88 0.81
89 0.82
90 0.8
91 0.76
92 0.69
93 0.63
94 0.59
95 0.53
96 0.51
97 0.48
98 0.45
99 0.41
100 0.37
101 0.36
102 0.3
103 0.27
104 0.2
105 0.15
106 0.14
107 0.18
108 0.22
109 0.27