Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507D2S9

Protein Details
Accession A0A507D2S9    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-21WEKPARPLKKWSKNDVEEKVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9.333, mito 7, cyto 7, cyto_pero 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR036736  ACP-like_sf  
Amino Acid Sequences MWEKPARPLKKWSKNDVEEKVLDMLLDAAKVNDDVVTLEANLVYDLLMDDRERFGLYWDLQEEFQFNIPPLRRFARDLASGREAVDWVASYLEQQERLKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.79
4 0.73
5 0.63
6 0.56
7 0.48
8 0.37
9 0.29
10 0.2
11 0.15
12 0.09
13 0.09
14 0.07
15 0.05
16 0.06
17 0.06
18 0.06
19 0.05
20 0.04
21 0.05
22 0.05
23 0.06
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.04
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.06
40 0.05
41 0.07
42 0.1
43 0.1
44 0.12
45 0.12
46 0.13
47 0.13
48 0.13
49 0.13
50 0.1
51 0.11
52 0.1
53 0.09
54 0.14
55 0.16
56 0.18
57 0.21
58 0.24
59 0.25
60 0.28
61 0.31
62 0.31
63 0.36
64 0.37
65 0.39
66 0.39
67 0.37
68 0.34
69 0.31
70 0.26
71 0.19
72 0.16
73 0.11
74 0.08
75 0.08
76 0.08
77 0.07
78 0.12
79 0.14
80 0.19