Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507CUT7

Protein Details
Accession A0A507CUT7    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
21-43NNIIERKSRKIQQKNQKLQKSYHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito_nucl 12.5, mito 9.5
Family & Domain DBs
Amino Acid Sequences MELISPNPPNHRIRNIFCIHNNIIERKSRKIQQKNQKLQKSYHSSSYMYCSFYGSLVTTTESRMPRELQGGDKRSQPSRPYNVAPLIHMLKIIFPEDRTVFVFDGALTSAKSETSMKRHREWGKVVNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.6
3 0.6
4 0.57
5 0.58
6 0.5
7 0.49
8 0.47
9 0.42
10 0.41
11 0.43
12 0.43
13 0.42
14 0.47
15 0.48
16 0.55
17 0.62
18 0.69
19 0.72
20 0.8
21 0.84
22 0.87
23 0.88
24 0.82
25 0.74
26 0.74
27 0.72
28 0.63
29 0.59
30 0.52
31 0.44
32 0.41
33 0.43
34 0.36
35 0.28
36 0.25
37 0.19
38 0.16
39 0.16
40 0.15
41 0.1
42 0.09
43 0.08
44 0.09
45 0.08
46 0.09
47 0.14
48 0.14
49 0.15
50 0.16
51 0.16
52 0.16
53 0.19
54 0.19
55 0.2
56 0.26
57 0.29
58 0.29
59 0.33
60 0.34
61 0.34
62 0.37
63 0.36
64 0.37
65 0.39
66 0.42
67 0.4
68 0.42
69 0.45
70 0.41
71 0.36
72 0.33
73 0.28
74 0.23
75 0.21
76 0.17
77 0.13
78 0.13
79 0.14
80 0.11
81 0.09
82 0.14
83 0.14
84 0.16
85 0.17
86 0.19
87 0.17
88 0.17
89 0.16
90 0.12
91 0.12
92 0.11
93 0.1
94 0.07
95 0.08
96 0.08
97 0.08
98 0.1
99 0.13
100 0.17
101 0.26
102 0.35
103 0.4
104 0.45
105 0.55
106 0.6
107 0.65
108 0.67