Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507D5H5

Protein Details
Accession A0A507D5H5    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-40TAYHTILFRRREKPRKIDLRFKTIKQHydrophilic
NLS Segment(s)
PositionSequence
25-30REKPRK
Subcellular Location(s) mito 9.5, nucl 8.5, cyto_mito 6.833, cyto_nucl 6.333, cyto 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016721  Bet3  
IPR024096  NO_sig/Golgi_transp_ligand-bd  
IPR007194  TRAPP_component  
Gene Ontology GO:0030008  C:TRAPP complex  
GO:0048193  P:Golgi vesicle transport  
Pfam View protein in Pfam  
PF04051  TRAPP  
CDD cd14942  TRAPPC3_bet3  
Amino Acid Sequences MPFIKSKLVHITASTAYHTILFRRREKPRKIDLRFKTIKQPLAMSKTQPKPVTPDELWKSRIEKINGELFSLTYGSVVAQLIKDYEDYGQVNKQLDKMGYNIGIRLIEDFLSKAPIPRCTDFRETAETISKSGFKLFFGSTPQIAKWGPSNKEFSLLLDDNPLTDFVELPDDASELYYSNVLCGVLRGALEMVGMLVECFFVQDILRGDETTEIRVKLVRILEEEVPASED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.22
3 0.19
4 0.2
5 0.2
6 0.21
7 0.26
8 0.32
9 0.37
10 0.46
11 0.56
12 0.64
13 0.73
14 0.77
15 0.81
16 0.84
17 0.85
18 0.86
19 0.83
20 0.83
21 0.8
22 0.74
23 0.73
24 0.69
25 0.66
26 0.57
27 0.56
28 0.52
29 0.52
30 0.52
31 0.47
32 0.5
33 0.51
34 0.56
35 0.53
36 0.47
37 0.47
38 0.48
39 0.5
40 0.42
41 0.45
42 0.43
43 0.46
44 0.48
45 0.44
46 0.43
47 0.41
48 0.46
49 0.39
50 0.36
51 0.35
52 0.41
53 0.38
54 0.36
55 0.3
56 0.23
57 0.21
58 0.18
59 0.14
60 0.06
61 0.06
62 0.05
63 0.06
64 0.06
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.08
74 0.09
75 0.1
76 0.12
77 0.14
78 0.16
79 0.16
80 0.16
81 0.16
82 0.16
83 0.15
84 0.14
85 0.14
86 0.14
87 0.14
88 0.13
89 0.12
90 0.11
91 0.1
92 0.1
93 0.08
94 0.06
95 0.06
96 0.06
97 0.06
98 0.08
99 0.08
100 0.11
101 0.12
102 0.16
103 0.2
104 0.22
105 0.25
106 0.28
107 0.32
108 0.31
109 0.31
110 0.32
111 0.28
112 0.28
113 0.3
114 0.26
115 0.22
116 0.2
117 0.19
118 0.14
119 0.16
120 0.15
121 0.1
122 0.12
123 0.12
124 0.13
125 0.15
126 0.17
127 0.16
128 0.16
129 0.16
130 0.16
131 0.16
132 0.15
133 0.18
134 0.23
135 0.25
136 0.27
137 0.32
138 0.3
139 0.33
140 0.32
141 0.27
142 0.27
143 0.25
144 0.22
145 0.2
146 0.2
147 0.17
148 0.17
149 0.16
150 0.09
151 0.09
152 0.08
153 0.06
154 0.09
155 0.09
156 0.09
157 0.09
158 0.08
159 0.08
160 0.08
161 0.08
162 0.06
163 0.06
164 0.07
165 0.07
166 0.07
167 0.07
168 0.07
169 0.07
170 0.07
171 0.07
172 0.06
173 0.07
174 0.07
175 0.06
176 0.06
177 0.06
178 0.06
179 0.05
180 0.04
181 0.04
182 0.03
183 0.03
184 0.03
185 0.03
186 0.04
187 0.04
188 0.04
189 0.05
190 0.09
191 0.11
192 0.14
193 0.15
194 0.15
195 0.16
196 0.2
197 0.21
198 0.22
199 0.23
200 0.21
201 0.21
202 0.23
203 0.23
204 0.23
205 0.25
206 0.24
207 0.23
208 0.27
209 0.28
210 0.29
211 0.29