Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507C884

Protein Details
Accession A0A507C884    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
21-43THYWSQHSVRRQKHNLKPGRDNSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 8, cyto 5.5, cyto_pero 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008278  4-PPantetheinyl_Trfase_dom  
IPR037143  4-PPantetheinyl_Trfase_dom_sf  
Gene Ontology GO:0008897  F:holo-[acyl-carrier-protein] synthase activity  
GO:0000287  F:magnesium ion binding  
Pfam View protein in Pfam  
PF01648  ACPS  
Amino Acid Sequences MKRQRHGTSLLDPDMMVLQITHYWSQHSVRRQKHNLKPGRDNSVRVYWRAATCPKDIDTYMLANRISSTQEWREFGKNFPSFASSKHQVLSNGWKWATLNARHDAWPLEERHLVRWLSVRWVAKEAVFKAIYPHRRMQWSDVSIVKHSGKPQIEFSPHVIMDLPIERAHLSISHDGDYIVAFVTVCCT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.24
3 0.16
4 0.08
5 0.07
6 0.08
7 0.11
8 0.12
9 0.12
10 0.14
11 0.17
12 0.22
13 0.27
14 0.35
15 0.41
16 0.49
17 0.59
18 0.67
19 0.74
20 0.79
21 0.84
22 0.83
23 0.82
24 0.84
25 0.79
26 0.79
27 0.72
28 0.66
29 0.61
30 0.61
31 0.55
32 0.46
33 0.43
34 0.37
35 0.35
36 0.37
37 0.37
38 0.31
39 0.31
40 0.33
41 0.3
42 0.29
43 0.27
44 0.25
45 0.21
46 0.21
47 0.2
48 0.2
49 0.18
50 0.16
51 0.16
52 0.14
53 0.14
54 0.12
55 0.16
56 0.18
57 0.21
58 0.22
59 0.24
60 0.28
61 0.27
62 0.29
63 0.33
64 0.29
65 0.27
66 0.26
67 0.27
68 0.22
69 0.24
70 0.29
71 0.22
72 0.22
73 0.22
74 0.23
75 0.21
76 0.23
77 0.29
78 0.24
79 0.25
80 0.24
81 0.23
82 0.22
83 0.24
84 0.27
85 0.22
86 0.23
87 0.23
88 0.24
89 0.24
90 0.25
91 0.23
92 0.2
93 0.2
94 0.18
95 0.18
96 0.2
97 0.2
98 0.22
99 0.26
100 0.23
101 0.2
102 0.22
103 0.2
104 0.21
105 0.25
106 0.25
107 0.21
108 0.24
109 0.24
110 0.22
111 0.26
112 0.23
113 0.24
114 0.22
115 0.21
116 0.23
117 0.3
118 0.34
119 0.35
120 0.38
121 0.37
122 0.42
123 0.44
124 0.45
125 0.46
126 0.42
127 0.41
128 0.4
129 0.38
130 0.34
131 0.36
132 0.33
133 0.28
134 0.28
135 0.32
136 0.31
137 0.31
138 0.35
139 0.37
140 0.38
141 0.38
142 0.4
143 0.38
144 0.35
145 0.33
146 0.29
147 0.22
148 0.21
149 0.21
150 0.19
151 0.12
152 0.13
153 0.13
154 0.13
155 0.14
156 0.12
157 0.15
158 0.19
159 0.21
160 0.21
161 0.21
162 0.21
163 0.2
164 0.18
165 0.14
166 0.09
167 0.07
168 0.06