Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507CN49

Protein Details
Accession A0A507CN49   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
48-74TGTPTAPIRRLKTPRRRTKRDTGTSILHydrophilic
NLS Segment(s)
PositionSequence
57-66RLKTPRRRTK
Subcellular Location(s) E.R. 2, extr 17, mito 2, plas 6
Family & Domain DBs
Amino Acid Sequences MAVYTILVLLLLSSALIAHAQTGYLQGRYDLIHPELIHPNHIPQYTRTGTPTAPIRRLKTPRRRTKRDTGTSILNISASFQLEFTCRNTNACDSAQTTFVRAAQRLAQVLSLPSTIVISATFESFCIANARDCDSSTLGVAAPASFHTWSDVAAGALGVDTGYSYPSALAKQLAPNDTTWGPAGAVGSTVVDIYARFNADFPWWFTSKSSTPPPATSRHAPYDFEQTVLHELTHGLGFISSWYPWLSNATLLPSPPVTDANGVYMGLAKPYIFNKWMVDSVALTWYYDYANRIMSDAAGEVATNDYGLWLRSFQGTDGYALAGSLMTNISTSNMRTLFMYPLVAMSQDYGYAVLYTPTNFSTGSSMSHLDAAFYDGSSEFLMRPFGTPYTALDDYSPMGALGPMGEVTLACLGALGYTTILDLVLASP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.04
3 0.04
4 0.04
5 0.05
6 0.05
7 0.06
8 0.06
9 0.11
10 0.13
11 0.14
12 0.14
13 0.14
14 0.15
15 0.16
16 0.18
17 0.18
18 0.18
19 0.21
20 0.21
21 0.26
22 0.33
23 0.32
24 0.34
25 0.31
26 0.34
27 0.36
28 0.37
29 0.35
30 0.28
31 0.36
32 0.35
33 0.37
34 0.35
35 0.32
36 0.3
37 0.33
38 0.4
39 0.39
40 0.44
41 0.48
42 0.5
43 0.57
44 0.66
45 0.72
46 0.74
47 0.78
48 0.81
49 0.85
50 0.9
51 0.89
52 0.9
53 0.91
54 0.89
55 0.86
56 0.79
57 0.76
58 0.69
59 0.62
60 0.51
61 0.4
62 0.3
63 0.24
64 0.21
65 0.14
66 0.12
67 0.1
68 0.11
69 0.11
70 0.14
71 0.15
72 0.2
73 0.19
74 0.21
75 0.24
76 0.25
77 0.28
78 0.27
79 0.27
80 0.23
81 0.23
82 0.26
83 0.23
84 0.22
85 0.19
86 0.22
87 0.22
88 0.2
89 0.21
90 0.21
91 0.24
92 0.24
93 0.23
94 0.2
95 0.17
96 0.17
97 0.17
98 0.12
99 0.09
100 0.08
101 0.08
102 0.07
103 0.06
104 0.06
105 0.06
106 0.06
107 0.07
108 0.07
109 0.07
110 0.08
111 0.08
112 0.08
113 0.09
114 0.1
115 0.11
116 0.13
117 0.17
118 0.17
119 0.17
120 0.19
121 0.17
122 0.17
123 0.15
124 0.14
125 0.1
126 0.09
127 0.09
128 0.07
129 0.06
130 0.06
131 0.07
132 0.07
133 0.07
134 0.08
135 0.08
136 0.08
137 0.09
138 0.09
139 0.07
140 0.07
141 0.06
142 0.05
143 0.04
144 0.04
145 0.03
146 0.02
147 0.02
148 0.02
149 0.03
150 0.03
151 0.03
152 0.04
153 0.05
154 0.06
155 0.06
156 0.08
157 0.09
158 0.12
159 0.15
160 0.17
161 0.17
162 0.16
163 0.19
164 0.18
165 0.17
166 0.14
167 0.11
168 0.1
169 0.09
170 0.09
171 0.06
172 0.06
173 0.05
174 0.05
175 0.04
176 0.04
177 0.03
178 0.03
179 0.03
180 0.04
181 0.05
182 0.06
183 0.06
184 0.06
185 0.07
186 0.09
187 0.1
188 0.11
189 0.13
190 0.14
191 0.14
192 0.15
193 0.18
194 0.18
195 0.22
196 0.24
197 0.25
198 0.26
199 0.29
200 0.31
201 0.31
202 0.34
203 0.34
204 0.34
205 0.35
206 0.35
207 0.33
208 0.32
209 0.36
210 0.32
211 0.28
212 0.24
213 0.19
214 0.2
215 0.18
216 0.17
217 0.08
218 0.08
219 0.08
220 0.08
221 0.07
222 0.04
223 0.04
224 0.04
225 0.04
226 0.05
227 0.04
228 0.05
229 0.06
230 0.06
231 0.06
232 0.09
233 0.08
234 0.09
235 0.09
236 0.11
237 0.11
238 0.11
239 0.12
240 0.1
241 0.1
242 0.1
243 0.11
244 0.09
245 0.1
246 0.1
247 0.1
248 0.1
249 0.09
250 0.09
251 0.09
252 0.08
253 0.07
254 0.07
255 0.06
256 0.07
257 0.08
258 0.11
259 0.11
260 0.12
261 0.13
262 0.15
263 0.16
264 0.15
265 0.15
266 0.12
267 0.12
268 0.13
269 0.12
270 0.1
271 0.09
272 0.09
273 0.09
274 0.1
275 0.1
276 0.09
277 0.11
278 0.11
279 0.12
280 0.11
281 0.1
282 0.1
283 0.08
284 0.08
285 0.06
286 0.05
287 0.05
288 0.06
289 0.05
290 0.05
291 0.04
292 0.04
293 0.05
294 0.06
295 0.06
296 0.06
297 0.07
298 0.09
299 0.1
300 0.09
301 0.12
302 0.12
303 0.13
304 0.13
305 0.12
306 0.1
307 0.09
308 0.09
309 0.06
310 0.05
311 0.05
312 0.04
313 0.04
314 0.04
315 0.04
316 0.06
317 0.07
318 0.08
319 0.12
320 0.13
321 0.13
322 0.15
323 0.16
324 0.17
325 0.17
326 0.17
327 0.12
328 0.13
329 0.12
330 0.11
331 0.1
332 0.09
333 0.08
334 0.07
335 0.07
336 0.07
337 0.07
338 0.07
339 0.07
340 0.07
341 0.07
342 0.08
343 0.09
344 0.1
345 0.11
346 0.1
347 0.11
348 0.13
349 0.13
350 0.15
351 0.16
352 0.17
353 0.16
354 0.19
355 0.18
356 0.15
357 0.15
358 0.15
359 0.13
360 0.11
361 0.12
362 0.09
363 0.1
364 0.1
365 0.11
366 0.09
367 0.09
368 0.12
369 0.11
370 0.13
371 0.14
372 0.15
373 0.16
374 0.16
375 0.17
376 0.23
377 0.23
378 0.22
379 0.2
380 0.21
381 0.2
382 0.19
383 0.17
384 0.1
385 0.09
386 0.09
387 0.08
388 0.07
389 0.06
390 0.06
391 0.05
392 0.05
393 0.05
394 0.07
395 0.08
396 0.07
397 0.06
398 0.06
399 0.06
400 0.06
401 0.07
402 0.06
403 0.05
404 0.05
405 0.05
406 0.05
407 0.05
408 0.05