Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507DIJ9

Protein Details
Accession A0A507DIJ9   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-36GDQATISHTRKRRRKACRPCRCSLDARHydrophilic
NLS Segment(s)
PositionSequence
21-22RR
Subcellular Location(s) cyto 6.5, cyto_nucl 11.5, mito 3, nucl 15.5
Family & Domain DBs
Amino Acid Sequences MSGRWLGDGGDQATISHTRKRRRKACRPCRCSLDARSYRKSILYRLAQVTTPLDVVLSINTVTKGGFSVSRSSWSKRQRLSLWINKPSKMVQLIEERARRSSTISSCAQFDYDSLKSNAISYLLRVVNTLRSGTISRPFSRFRGDVEVDVDCVLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.25
4 0.31
5 0.4
6 0.49
7 0.6
8 0.67
9 0.73
10 0.82
11 0.86
12 0.9
13 0.91
14 0.9
15 0.88
16 0.86
17 0.8
18 0.76
19 0.71
20 0.71
21 0.69
22 0.68
23 0.66
24 0.6
25 0.56
26 0.54
27 0.49
28 0.42
29 0.41
30 0.38
31 0.38
32 0.38
33 0.38
34 0.34
35 0.33
36 0.3
37 0.22
38 0.17
39 0.12
40 0.09
41 0.07
42 0.07
43 0.06
44 0.05
45 0.05
46 0.05
47 0.05
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.07
54 0.08
55 0.11
56 0.11
57 0.17
58 0.19
59 0.22
60 0.29
61 0.35
62 0.4
63 0.4
64 0.45
65 0.42
66 0.47
67 0.53
68 0.54
69 0.54
70 0.57
71 0.57
72 0.52
73 0.51
74 0.44
75 0.39
76 0.32
77 0.25
78 0.2
79 0.24
80 0.27
81 0.32
82 0.34
83 0.32
84 0.32
85 0.32
86 0.28
87 0.24
88 0.26
89 0.23
90 0.25
91 0.26
92 0.26
93 0.26
94 0.26
95 0.24
96 0.18
97 0.16
98 0.17
99 0.15
100 0.17
101 0.17
102 0.17
103 0.16
104 0.17
105 0.17
106 0.13
107 0.12
108 0.1
109 0.16
110 0.16
111 0.16
112 0.16
113 0.17
114 0.19
115 0.21
116 0.2
117 0.14
118 0.16
119 0.17
120 0.2
121 0.27
122 0.28
123 0.3
124 0.34
125 0.38
126 0.38
127 0.44
128 0.42
129 0.38
130 0.41
131 0.41
132 0.38
133 0.38
134 0.36
135 0.3