Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507DAS5

Protein Details
Accession A0A507DAS5    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-40GKMPAKTAEKKPSDKKKNRKTRKETYSTYIHydrophilic
NLS Segment(s)
PositionSequence
4-33KAEKKPAGKMPAKTAEKKPSDKKKNRKTRK
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MPPKAEKKPAGKMPAKTAEKKPSDKKKNRKTRKETYSTYIYKVLKQVHPDTGISNKAMSIMNSFVNDIFERIATEASKLASYNKRSTISSREIQTAVRLILPGELSKHAVSEGTKAVTKYQSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.71
3 0.68
4 0.67
5 0.67
6 0.68
7 0.72
8 0.73
9 0.74
10 0.79
11 0.83
12 0.86
13 0.87
14 0.91
15 0.93
16 0.94
17 0.93
18 0.92
19 0.92
20 0.89
21 0.83
22 0.78
23 0.76
24 0.67
25 0.61
26 0.57
27 0.47
28 0.41
29 0.4
30 0.4
31 0.33
32 0.36
33 0.36
34 0.32
35 0.33
36 0.32
37 0.28
38 0.26
39 0.25
40 0.2
41 0.17
42 0.13
43 0.13
44 0.12
45 0.11
46 0.09
47 0.09
48 0.09
49 0.09
50 0.1
51 0.08
52 0.09
53 0.09
54 0.08
55 0.07
56 0.06
57 0.06
58 0.07
59 0.07
60 0.06
61 0.07
62 0.07
63 0.07
64 0.08
65 0.08
66 0.13
67 0.18
68 0.23
69 0.26
70 0.3
71 0.32
72 0.33
73 0.36
74 0.38
75 0.38
76 0.39
77 0.37
78 0.35
79 0.34
80 0.33
81 0.32
82 0.27
83 0.22
84 0.17
85 0.15
86 0.12
87 0.12
88 0.13
89 0.12
90 0.12
91 0.13
92 0.15
93 0.15
94 0.15
95 0.13
96 0.14
97 0.14
98 0.16
99 0.17
100 0.18
101 0.2
102 0.21
103 0.25
104 0.28