Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507D733

Protein Details
Accession A0A507D733    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
38-65RLRIRIERLSRRREKPRKSGPRVQAQILHydrophilic
NLS Segment(s)
PositionSequence
37-76VRLRIRIERLSRRREKPRKSGPRVQAQILGLLGKQRKKPG
Subcellular Location(s) mito 18, nucl 6.5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MRTPHPSPSVHALMMFSKSLRKTDEAIFATIVAGGRVRLRIRIERLSRRREKPRKSGPRVQAQILGLLGKQRKKPGQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.16
4 0.17
5 0.18
6 0.2
7 0.21
8 0.22
9 0.23
10 0.26
11 0.33
12 0.3
13 0.3
14 0.27
15 0.25
16 0.22
17 0.2
18 0.16
19 0.07
20 0.06
21 0.05
22 0.06
23 0.08
24 0.08
25 0.11
26 0.13
27 0.18
28 0.22
29 0.3
30 0.36
31 0.44
32 0.52
33 0.59
34 0.65
35 0.69
36 0.76
37 0.78
38 0.8
39 0.8
40 0.84
41 0.85
42 0.86
43 0.87
44 0.84
45 0.85
46 0.8
47 0.72
48 0.66
49 0.55
50 0.48
51 0.39
52 0.31
53 0.21
54 0.23
55 0.26
56 0.26
57 0.31
58 0.38