Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507DE57

Protein Details
Accession A0A507DE57    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MRRKRVRIRGVKTRETPRERDBasic
NLS Segment(s)
PositionSequence
4-8KRVRI
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004018  RPEL_repeat  
PROSITE View protein in PROSITE  
PS51073  RPEL  
Amino Acid Sequences MRRKRVRIRGVKTRETPRERDLLHGPHDYNRVFVINHPKQELIMADEASTKDVKAELSKHLARRPSPSELEDTLAHKVTQRLTKSELEAKNILKQDTNLSGALHAAANELEKARLCDAVEQQLKRRVSPEELEAKGIIKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.8
3 0.77
4 0.7
5 0.69
6 0.6
7 0.57
8 0.54
9 0.49
10 0.47
11 0.46
12 0.43
13 0.4
14 0.44
15 0.39
16 0.32
17 0.28
18 0.24
19 0.2
20 0.23
21 0.3
22 0.29
23 0.32
24 0.33
25 0.32
26 0.3
27 0.31
28 0.27
29 0.19
30 0.16
31 0.13
32 0.12
33 0.13
34 0.13
35 0.13
36 0.13
37 0.09
38 0.07
39 0.08
40 0.08
41 0.09
42 0.11
43 0.13
44 0.2
45 0.23
46 0.26
47 0.29
48 0.33
49 0.32
50 0.36
51 0.37
52 0.35
53 0.34
54 0.32
55 0.32
56 0.28
57 0.29
58 0.25
59 0.22
60 0.19
61 0.17
62 0.16
63 0.13
64 0.14
65 0.15
66 0.2
67 0.2
68 0.21
69 0.24
70 0.26
71 0.28
72 0.35
73 0.33
74 0.31
75 0.33
76 0.32
77 0.34
78 0.34
79 0.32
80 0.24
81 0.23
82 0.23
83 0.22
84 0.23
85 0.18
86 0.16
87 0.15
88 0.15
89 0.15
90 0.11
91 0.08
92 0.06
93 0.06
94 0.06
95 0.07
96 0.08
97 0.08
98 0.09
99 0.11
100 0.11
101 0.13
102 0.13
103 0.17
104 0.19
105 0.28
106 0.34
107 0.35
108 0.4
109 0.46
110 0.47
111 0.43
112 0.43
113 0.38
114 0.37
115 0.38
116 0.4
117 0.41
118 0.41
119 0.42
120 0.4