Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A507DLA9

Protein Details
Accession A0A507DLA9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
55-83TQYQERFERKHDKKRRKRQESHWRKYMGFBasic
NLS Segment(s)
PositionSequence
63-81RKHDKKRRKRQESHWRKYM
Subcellular Location(s) mito 17, nucl 8.5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MNCLHQATSRLHFSPIQYLQLTLSHLSIPTTFTIRGYRKHALQSIESRGRTVCVTQYQERFERKHDKKRRKRQESHWRKYMGFVKGEVKKAWSLKRRTLLEEENYRNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.34
4 0.29
5 0.28
6 0.27
7 0.26
8 0.26
9 0.18
10 0.16
11 0.12
12 0.12
13 0.12
14 0.11
15 0.11
16 0.1
17 0.12
18 0.11
19 0.12
20 0.2
21 0.22
22 0.26
23 0.31
24 0.33
25 0.34
26 0.38
27 0.41
28 0.36
29 0.37
30 0.38
31 0.4
32 0.42
33 0.39
34 0.35
35 0.31
36 0.29
37 0.25
38 0.21
39 0.16
40 0.14
41 0.18
42 0.22
43 0.25
44 0.27
45 0.31
46 0.35
47 0.34
48 0.35
49 0.42
50 0.46
51 0.54
52 0.61
53 0.68
54 0.75
55 0.85
56 0.9
57 0.9
58 0.92
59 0.92
60 0.93
61 0.93
62 0.91
63 0.88
64 0.81
65 0.71
66 0.69
67 0.65
68 0.59
69 0.49
70 0.43
71 0.43
72 0.44
73 0.48
74 0.41
75 0.36
76 0.37
77 0.41
78 0.48
79 0.48
80 0.5
81 0.55
82 0.63
83 0.65
84 0.65
85 0.66
86 0.64
87 0.64
88 0.67