Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A507CJJ3

Protein Details
Accession A0A507CJJ3    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-32VSHFHPTKKNVHPKKSYPLLLHydrophilic
139-162YDIARAYYSTKRYKRKRWDADKASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 9.5, cyto_nucl 8, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSAARISVSTFVSHFHPTKKNVHPKKSYPLLLSRGTPRQNATITVLDQESYRLTRRSFLVNDDVKTGLAAALEAEFKVEKAPGEADVYIGRVATDLDIVVSGDSDVFCYRNVKTMVQREFTKSDQETWAEFLERFVISYDIARAYYSTKRYKRKRWDADKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.34
4 0.38
5 0.47
6 0.55
7 0.63
8 0.67
9 0.74
10 0.76
11 0.76
12 0.81
13 0.81
14 0.76
15 0.69
16 0.66
17 0.61
18 0.55
19 0.52
20 0.49
21 0.48
22 0.46
23 0.44
24 0.39
25 0.38
26 0.36
27 0.35
28 0.33
29 0.28
30 0.25
31 0.24
32 0.22
33 0.17
34 0.16
35 0.15
36 0.12
37 0.12
38 0.14
39 0.15
40 0.15
41 0.18
42 0.19
43 0.24
44 0.24
45 0.25
46 0.31
47 0.31
48 0.32
49 0.3
50 0.29
51 0.23
52 0.22
53 0.18
54 0.1
55 0.06
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.04
67 0.05
68 0.06
69 0.06
70 0.08
71 0.08
72 0.08
73 0.08
74 0.08
75 0.08
76 0.07
77 0.06
78 0.05
79 0.05
80 0.04
81 0.04
82 0.03
83 0.03
84 0.03
85 0.04
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.04
92 0.05
93 0.05
94 0.06
95 0.08
96 0.09
97 0.15
98 0.17
99 0.2
100 0.26
101 0.35
102 0.39
103 0.42
104 0.44
105 0.42
106 0.44
107 0.42
108 0.43
109 0.35
110 0.34
111 0.32
112 0.32
113 0.28
114 0.26
115 0.26
116 0.21
117 0.19
118 0.17
119 0.16
120 0.14
121 0.13
122 0.12
123 0.11
124 0.1
125 0.11
126 0.13
127 0.11
128 0.12
129 0.11
130 0.11
131 0.14
132 0.2
133 0.26
134 0.35
135 0.43
136 0.53
137 0.63
138 0.73
139 0.81
140 0.86
141 0.9
142 0.91