Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517LI87

Protein Details
Accession A0A517LI87    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
142-209EEDKEEKQPVKKKQKKEDDAPAEPKKGRGRPKKATTEANGTNGNDKKDKATPAKKKTPKKAATEDGEPBasic
NLS Segment(s)
PositionSequence
148-217KQPVKKKQKKEDDAPAEPKKGRGRPKKATTEANGTNGNDKKDKATPAKKKTPKKAATEDGEPRRSGRNKS
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021331  Hva1_TUDOR  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MADQVEKGDQVSWQYGGSAPSGEVSKVVEEGEAKVVSHRGNEITKDAKPDDPAVEVSRSGNDVVKNASELNVEEKASGANGDEKDSANGKEEETSGNSKTGEKRNHEESEKNGDSEAQENGESKAEKEDEDKQDEAESDEKEEDKEEKQPVKKKQKKEDDAPAEPKKGRGRPKKATTEANGTNGNDKKDKATPAKKKTPKKAATEDGEPRRSGRNKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.16
4 0.15
5 0.13
6 0.1
7 0.12
8 0.12
9 0.12
10 0.11
11 0.11
12 0.11
13 0.1
14 0.1
15 0.1
16 0.09
17 0.11
18 0.15
19 0.14
20 0.13
21 0.14
22 0.16
23 0.16
24 0.16
25 0.17
26 0.17
27 0.19
28 0.21
29 0.24
30 0.26
31 0.27
32 0.3
33 0.31
34 0.29
35 0.28
36 0.29
37 0.26
38 0.24
39 0.25
40 0.22
41 0.21
42 0.2
43 0.18
44 0.16
45 0.16
46 0.15
47 0.15
48 0.13
49 0.13
50 0.14
51 0.13
52 0.14
53 0.13
54 0.13
55 0.1
56 0.1
57 0.13
58 0.13
59 0.13
60 0.11
61 0.11
62 0.11
63 0.1
64 0.09
65 0.06
66 0.09
67 0.09
68 0.11
69 0.12
70 0.13
71 0.14
72 0.16
73 0.16
74 0.14
75 0.14
76 0.13
77 0.13
78 0.13
79 0.13
80 0.14
81 0.16
82 0.14
83 0.14
84 0.15
85 0.16
86 0.2
87 0.27
88 0.3
89 0.32
90 0.36
91 0.41
92 0.45
93 0.45
94 0.42
95 0.38
96 0.41
97 0.37
98 0.33
99 0.27
100 0.23
101 0.21
102 0.2
103 0.17
104 0.08
105 0.08
106 0.09
107 0.09
108 0.11
109 0.11
110 0.09
111 0.12
112 0.11
113 0.11
114 0.14
115 0.21
116 0.23
117 0.27
118 0.27
119 0.24
120 0.24
121 0.24
122 0.23
123 0.18
124 0.14
125 0.12
126 0.13
127 0.13
128 0.12
129 0.14
130 0.14
131 0.13
132 0.18
133 0.22
134 0.29
135 0.36
136 0.44
137 0.53
138 0.62
139 0.69
140 0.73
141 0.78
142 0.82
143 0.83
144 0.83
145 0.84
146 0.81
147 0.81
148 0.8
149 0.74
150 0.69
151 0.61
152 0.59
153 0.57
154 0.55
155 0.58
156 0.6
157 0.64
158 0.69
159 0.78
160 0.83
161 0.81
162 0.81
163 0.76
164 0.74
165 0.68
166 0.62
167 0.56
168 0.47
169 0.49
170 0.43
171 0.42
172 0.36
173 0.33
174 0.33
175 0.35
176 0.42
177 0.45
178 0.52
179 0.59
180 0.66
181 0.76
182 0.81
183 0.86
184 0.89
185 0.9
186 0.88
187 0.86
188 0.86
189 0.84
190 0.81
191 0.79
192 0.78
193 0.77
194 0.73
195 0.64
196 0.57
197 0.57