Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A517L5W8

Protein Details
Accession A0A517L5W8    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
109-133QTDALRRKKERLKRRSESPKAPPGGBasic
NLS Segment(s)
PositionSequence
114-130RRKKERLKRRSESPKAP
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR033473  Atos-like_C  
IPR025261  Atos-like_cons_dom  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF13889  Chromosome_seg  
PF13915  DUF4210  
Amino Acid Sequences MSTTPSRPLNFVAQIGVLGKGKCKANLRCPPHVIVPFPAVFYSYGNAGGRMMDNQPSPYVGLIDLENSLPPPQDNEAEGRRRRRYASPATKLDETTSYGVSSSSGSLVQTDALRRKKERLKRRSESPKAPPGGSYRIPQQGQVQIILKNPNKTAVKLFLVPYDLSDMEPGQKTFIRQRSYSAGPIIDMPMSARSNLGTDRPEASLSHSEDPRDRPVLRYLVHLNICCPSKGRYYLHKAVRVVFANRVPDGKEKLRNEVQLPDPRYSAYKPQRDALATTAISAADKAARRRSTPFACMQSNSDATRLPSWTARSFNETPITSPIRSFADTVMRSPIRPIPFSLNRLETVESRPVSREQMDLDNPFRARTHSEDIPAGHIPDLWLEKRKSPLSSAGSSVASGISAGLLARQLREVSLERDDGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.23
4 0.19
5 0.17
6 0.18
7 0.22
8 0.25
9 0.29
10 0.38
11 0.44
12 0.51
13 0.61
14 0.66
15 0.7
16 0.72
17 0.71
18 0.7
19 0.65
20 0.57
21 0.5
22 0.48
23 0.4
24 0.36
25 0.31
26 0.24
27 0.21
28 0.19
29 0.16
30 0.12
31 0.15
32 0.15
33 0.15
34 0.14
35 0.14
36 0.14
37 0.15
38 0.16
39 0.16
40 0.17
41 0.19
42 0.19
43 0.19
44 0.19
45 0.17
46 0.15
47 0.11
48 0.11
49 0.1
50 0.1
51 0.1
52 0.1
53 0.1
54 0.09
55 0.1
56 0.1
57 0.1
58 0.12
59 0.13
60 0.15
61 0.16
62 0.21
63 0.28
64 0.37
65 0.43
66 0.5
67 0.54
68 0.56
69 0.58
70 0.6
71 0.62
72 0.64
73 0.68
74 0.68
75 0.68
76 0.69
77 0.67
78 0.61
79 0.53
80 0.44
81 0.36
82 0.29
83 0.23
84 0.18
85 0.16
86 0.15
87 0.13
88 0.12
89 0.09
90 0.08
91 0.08
92 0.08
93 0.08
94 0.08
95 0.09
96 0.1
97 0.15
98 0.22
99 0.27
100 0.32
101 0.35
102 0.43
103 0.51
104 0.59
105 0.65
106 0.68
107 0.73
108 0.75
109 0.83
110 0.86
111 0.86
112 0.85
113 0.83
114 0.82
115 0.74
116 0.67
117 0.59
118 0.53
119 0.5
120 0.43
121 0.36
122 0.33
123 0.36
124 0.36
125 0.35
126 0.35
127 0.33
128 0.31
129 0.32
130 0.28
131 0.23
132 0.26
133 0.32
134 0.31
135 0.29
136 0.29
137 0.33
138 0.32
139 0.32
140 0.32
141 0.28
142 0.28
143 0.27
144 0.28
145 0.22
146 0.23
147 0.21
148 0.18
149 0.16
150 0.14
151 0.12
152 0.12
153 0.1
154 0.11
155 0.13
156 0.12
157 0.11
158 0.12
159 0.14
160 0.21
161 0.27
162 0.28
163 0.27
164 0.3
165 0.34
166 0.36
167 0.36
168 0.3
169 0.23
170 0.2
171 0.2
172 0.18
173 0.12
174 0.09
175 0.07
176 0.09
177 0.09
178 0.09
179 0.09
180 0.08
181 0.09
182 0.1
183 0.12
184 0.1
185 0.11
186 0.12
187 0.13
188 0.13
189 0.13
190 0.16
191 0.18
192 0.2
193 0.22
194 0.21
195 0.22
196 0.24
197 0.26
198 0.26
199 0.25
200 0.22
201 0.21
202 0.24
203 0.27
204 0.25
205 0.26
206 0.25
207 0.26
208 0.28
209 0.26
210 0.23
211 0.22
212 0.22
213 0.19
214 0.18
215 0.15
216 0.17
217 0.22
218 0.25
219 0.29
220 0.37
221 0.45
222 0.5
223 0.53
224 0.5
225 0.47
226 0.48
227 0.42
228 0.36
229 0.31
230 0.27
231 0.25
232 0.24
233 0.22
234 0.2
235 0.21
236 0.25
237 0.26
238 0.32
239 0.31
240 0.38
241 0.41
242 0.42
243 0.4
244 0.4
245 0.41
246 0.41
247 0.42
248 0.37
249 0.33
250 0.31
251 0.32
252 0.28
253 0.32
254 0.34
255 0.38
256 0.38
257 0.4
258 0.43
259 0.42
260 0.42
261 0.34
262 0.3
263 0.23
264 0.21
265 0.19
266 0.16
267 0.14
268 0.13
269 0.11
270 0.09
271 0.12
272 0.16
273 0.23
274 0.25
275 0.28
276 0.32
277 0.4
278 0.41
279 0.43
280 0.46
281 0.44
282 0.45
283 0.44
284 0.42
285 0.38
286 0.37
287 0.33
288 0.27
289 0.22
290 0.22
291 0.23
292 0.21
293 0.19
294 0.19
295 0.22
296 0.25
297 0.28
298 0.28
299 0.33
300 0.33
301 0.36
302 0.38
303 0.34
304 0.32
305 0.34
306 0.37
307 0.29
308 0.28
309 0.26
310 0.24
311 0.24
312 0.23
313 0.19
314 0.24
315 0.25
316 0.26
317 0.31
318 0.29
319 0.28
320 0.3
321 0.34
322 0.29
323 0.3
324 0.31
325 0.33
326 0.38
327 0.42
328 0.44
329 0.41
330 0.38
331 0.39
332 0.38
333 0.31
334 0.3
335 0.33
336 0.29
337 0.28
338 0.29
339 0.29
340 0.31
341 0.3
342 0.27
343 0.23
344 0.29
345 0.33
346 0.35
347 0.35
348 0.37
349 0.35
350 0.35
351 0.32
352 0.28
353 0.28
354 0.29
355 0.34
356 0.32
357 0.35
358 0.37
359 0.37
360 0.39
361 0.36
362 0.31
363 0.24
364 0.2
365 0.17
366 0.18
367 0.22
368 0.21
369 0.27
370 0.28
371 0.32
372 0.4
373 0.44
374 0.43
375 0.42
376 0.48
377 0.46
378 0.47
379 0.45
380 0.41
381 0.37
382 0.34
383 0.31
384 0.22
385 0.15
386 0.12
387 0.09
388 0.05
389 0.05
390 0.05
391 0.05
392 0.08
393 0.09
394 0.1
395 0.13
396 0.13
397 0.13
398 0.18
399 0.21
400 0.22
401 0.26