Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517LAU7

Protein Details
Accession A0A517LAU7   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-63AYLINEHKKNKKEKARIQEEQANLPTSRSRPSRRRSNSPKRPKMYHEDRKYHydrophilic
NLS Segment(s)
PositionSequence
20-29KKNKKEKARI
38-55TSRSRPSRRRSNSPKRPK
Subcellular Location(s) cyto 3, extr 3, mito 7, nucl 14
Family & Domain DBs
Amino Acid Sequences MVLLGGLELLAGAYLINEHKKNKKEKARIQEEQANLPTSRSRPSRRRSNSPKRPKMYHEDRKYRSTSPCRYECSAKRRPHYDEPSSAKPTAAIVPPSYYHPPPPKGQHSPMLAYHRSSSTPPTEFAPRPLFHSPQAVARPLPPASPVSPIETDYHLHAPFDVPDGFSPEQRQHQPLYAHNYAPIHYPAHLAELGNPSVTGAYEPRFQYDDGLIYDERRNRHVRFAIPREGDETQFDVVHPRNVPPPPYSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.07
3 0.13
4 0.17
5 0.24
6 0.32
7 0.41
8 0.51
9 0.6
10 0.68
11 0.73
12 0.79
13 0.84
14 0.86
15 0.85
16 0.83
17 0.81
18 0.73
19 0.69
20 0.62
21 0.54
22 0.44
23 0.39
24 0.35
25 0.29
26 0.34
27 0.35
28 0.42
29 0.47
30 0.56
31 0.66
32 0.71
33 0.8
34 0.84
35 0.87
36 0.89
37 0.91
38 0.92
39 0.89
40 0.86
41 0.82
42 0.81
43 0.8
44 0.8
45 0.79
46 0.79
47 0.77
48 0.77
49 0.75
50 0.7
51 0.68
52 0.67
53 0.65
54 0.63
55 0.64
56 0.62
57 0.62
58 0.65
59 0.64
60 0.63
61 0.64
62 0.63
63 0.64
64 0.65
65 0.69
66 0.7
67 0.7
68 0.67
69 0.66
70 0.66
71 0.66
72 0.64
73 0.57
74 0.46
75 0.38
76 0.33
77 0.28
78 0.23
79 0.17
80 0.13
81 0.14
82 0.15
83 0.19
84 0.21
85 0.19
86 0.23
87 0.27
88 0.3
89 0.33
90 0.39
91 0.43
92 0.45
93 0.48
94 0.48
95 0.44
96 0.44
97 0.43
98 0.42
99 0.36
100 0.31
101 0.29
102 0.23
103 0.22
104 0.2
105 0.19
106 0.17
107 0.17
108 0.17
109 0.18
110 0.22
111 0.21
112 0.25
113 0.27
114 0.24
115 0.28
116 0.3
117 0.3
118 0.25
119 0.28
120 0.24
121 0.24
122 0.26
123 0.22
124 0.19
125 0.18
126 0.2
127 0.18
128 0.17
129 0.13
130 0.13
131 0.13
132 0.17
133 0.17
134 0.17
135 0.17
136 0.19
137 0.19
138 0.18
139 0.18
140 0.17
141 0.19
142 0.16
143 0.15
144 0.14
145 0.13
146 0.12
147 0.14
148 0.12
149 0.09
150 0.09
151 0.15
152 0.16
153 0.16
154 0.18
155 0.19
156 0.25
157 0.27
158 0.29
159 0.25
160 0.3
161 0.32
162 0.35
163 0.4
164 0.37
165 0.34
166 0.34
167 0.33
168 0.28
169 0.28
170 0.25
171 0.17
172 0.15
173 0.16
174 0.14
175 0.16
176 0.16
177 0.14
178 0.15
179 0.18
180 0.18
181 0.16
182 0.16
183 0.13
184 0.12
185 0.12
186 0.09
187 0.08
188 0.1
189 0.15
190 0.16
191 0.19
192 0.2
193 0.2
194 0.22
195 0.21
196 0.22
197 0.17
198 0.2
199 0.18
200 0.19
201 0.24
202 0.26
203 0.27
204 0.3
205 0.36
206 0.34
207 0.43
208 0.46
209 0.5
210 0.56
211 0.61
212 0.65
213 0.61
214 0.6
215 0.56
216 0.53
217 0.46
218 0.38
219 0.34
220 0.26
221 0.23
222 0.22
223 0.22
224 0.22
225 0.27
226 0.25
227 0.25
228 0.31
229 0.35
230 0.39