Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A517L3D4

Protein Details
Accession A0A517L3D4    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
18-43TDPDKDPKDKPKTPAKKPKPSADPECBasic
90-109SCVGKKKMDSCKQYHCCKKRHydrophilic
NLS Segment(s)
PositionSequence
25-36KDKPKTPAKKPK
Subcellular Location(s) extr 14, cyto 4, mito 3, vacu 3, E.R. 2, mito_nucl 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MRLSIISLLALAATGLATDPDKDPKDKPKTPAKKPKPSADPECEYKWVDYTSDCHQGNDLFCDGNGENTGCLTPTSPSLDDYANWLNVDSCVGKKKMDSCKQYHCCKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.04
4 0.05
5 0.06
6 0.08
7 0.15
8 0.18
9 0.2
10 0.25
11 0.35
12 0.44
13 0.48
14 0.53
15 0.58
16 0.66
17 0.74
18 0.81
19 0.81
20 0.82
21 0.83
22 0.86
23 0.83
24 0.81
25 0.79
26 0.74
27 0.69
28 0.62
29 0.58
30 0.51
31 0.44
32 0.36
33 0.29
34 0.22
35 0.18
36 0.14
37 0.14
38 0.15
39 0.22
40 0.22
41 0.2
42 0.21
43 0.22
44 0.21
45 0.2
46 0.17
47 0.09
48 0.09
49 0.12
50 0.11
51 0.1
52 0.11
53 0.09
54 0.08
55 0.08
56 0.09
57 0.06
58 0.06
59 0.06
60 0.06
61 0.08
62 0.12
63 0.12
64 0.13
65 0.14
66 0.15
67 0.14
68 0.19
69 0.2
70 0.17
71 0.17
72 0.16
73 0.15
74 0.14
75 0.16
76 0.13
77 0.12
78 0.17
79 0.19
80 0.19
81 0.22
82 0.3
83 0.39
84 0.47
85 0.53
86 0.54
87 0.64
88 0.72
89 0.8