Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517L0W1

Protein Details
Accession A0A517L0W1    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-40LWKIPWRLSKFQKARQRFRLRRVDAHydrophilic
77-103KYTIFDRKARRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
84-96KARRYRKGIHKLP
Subcellular Location(s) mito 24, mito_nucl 13.333, cyto_mito 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRLTNPLSVGLLWKIPWRLSKFQKARQRFRLRRVDAIVATVDHALKKKGTTTKAVEIWKEEMPTESEMLAKDKYTIFDRKARRYRKGIHKLPKWTRVSQRLNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.19
7 0.26
8 0.3
9 0.38
10 0.44
11 0.54
12 0.59
13 0.66
14 0.74
15 0.76
16 0.8
17 0.82
18 0.86
19 0.83
20 0.84
21 0.86
22 0.79
23 0.76
24 0.7
25 0.64
26 0.52
27 0.46
28 0.37
29 0.26
30 0.23
31 0.16
32 0.13
33 0.09
34 0.09
35 0.09
36 0.09
37 0.09
38 0.13
39 0.18
40 0.2
41 0.24
42 0.28
43 0.32
44 0.37
45 0.38
46 0.34
47 0.31
48 0.32
49 0.27
50 0.24
51 0.19
52 0.15
53 0.15
54 0.15
55 0.14
56 0.11
57 0.1
58 0.11
59 0.13
60 0.12
61 0.1
62 0.11
63 0.11
64 0.13
65 0.17
66 0.22
67 0.23
68 0.31
69 0.38
70 0.47
71 0.56
72 0.62
73 0.66
74 0.69
75 0.76
76 0.79
77 0.83
78 0.82
79 0.83
80 0.84
81 0.86
82 0.87
83 0.87
84 0.82
85 0.79
86 0.79
87 0.79
88 0.8
89 0.77
90 0.79