Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517LPU4

Protein Details
Accession A0A517LPU4   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGARHNRKRTRSRPRDRTTSNQPLRPHydrophilic
NLS Segment(s)
PositionSequence
7-13RKRTRSR
Subcellular Location(s) cyto 3.5, cyto_nucl 7.833, mito 10.5, mito_nucl 11.333, nucl 11
Family & Domain DBs
Amino Acid Sequences MGARHNRKRTRSRPRDRTTSNQPLRPFSNFSNPIGFSTISNSHDHWHQQYSQWQDRSKAQQQLQTQRERKEAMAAETQRLRIFGGEIGDEMSLCAPMLQVVMGLFNGRLDYEDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.88
4 0.86
5 0.85
6 0.85
7 0.82
8 0.76
9 0.71
10 0.65
11 0.62
12 0.56
13 0.5
14 0.42
15 0.45
16 0.42
17 0.4
18 0.4
19 0.37
20 0.34
21 0.32
22 0.29
23 0.18
24 0.2
25 0.21
26 0.19
27 0.2
28 0.19
29 0.18
30 0.2
31 0.22
32 0.2
33 0.2
34 0.18
35 0.2
36 0.25
37 0.31
38 0.36
39 0.38
40 0.37
41 0.37
42 0.4
43 0.45
44 0.45
45 0.45
46 0.4
47 0.42
48 0.46
49 0.53
50 0.55
51 0.57
52 0.56
53 0.52
54 0.53
55 0.49
56 0.43
57 0.39
58 0.35
59 0.29
60 0.31
61 0.29
62 0.3
63 0.3
64 0.31
65 0.26
66 0.24
67 0.21
68 0.14
69 0.14
70 0.11
71 0.11
72 0.1
73 0.09
74 0.1
75 0.09
76 0.09
77 0.08
78 0.07
79 0.05
80 0.05
81 0.05
82 0.04
83 0.04
84 0.05
85 0.04
86 0.04
87 0.04
88 0.05
89 0.06
90 0.06
91 0.06
92 0.06
93 0.07
94 0.07