Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517LD14

Protein Details
Accession A0A517LD14    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
223-254PSKTDTPPTDKPTPRKQPRKLEIRGSKKQETAHydrophilic
NLS Segment(s)
PositionSequence
236-249PRKQPRKLEIRGSK
Subcellular Location(s) cyto 12, nucl 4, mito 4, mito_nucl 4, pero 3
Family & Domain DBs
Amino Acid Sequences MPPKASPKDDKDVSKIEPVPLSPQEVQKREKQLAEAAEYARKAHESQAEAAAAQQRADEADDIDVKDKALEEVEKHEKTANEHIEKAKVIESGALQGAFAGAGIGAATGMGLGTAVGTLVGGVTAIPLTGLGALVGAGSGAIHGPWLKLPKFKDENGDQVGGQENKETRGKEKDMKEYEKGMKPLKDRLAGEVSNYTPFWPWSPLKAVMSKIPPTPQPSTKAPSKTDTPPTDKPTPRKQPRKLEIRGSKKQETAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.53
3 0.47
4 0.43
5 0.39
6 0.39
7 0.36
8 0.38
9 0.33
10 0.39
11 0.44
12 0.47
13 0.5
14 0.51
15 0.57
16 0.56
17 0.55
18 0.49
19 0.46
20 0.44
21 0.44
22 0.4
23 0.34
24 0.33
25 0.31
26 0.29
27 0.24
28 0.22
29 0.19
30 0.2
31 0.24
32 0.23
33 0.25
34 0.27
35 0.27
36 0.25
37 0.26
38 0.26
39 0.21
40 0.18
41 0.15
42 0.12
43 0.12
44 0.13
45 0.12
46 0.07
47 0.09
48 0.11
49 0.12
50 0.13
51 0.13
52 0.11
53 0.11
54 0.11
55 0.09
56 0.09
57 0.1
58 0.1
59 0.17
60 0.25
61 0.25
62 0.25
63 0.28
64 0.27
65 0.3
66 0.37
67 0.38
68 0.33
69 0.36
70 0.37
71 0.36
72 0.35
73 0.32
74 0.25
75 0.18
76 0.15
77 0.13
78 0.11
79 0.11
80 0.11
81 0.1
82 0.08
83 0.07
84 0.07
85 0.05
86 0.05
87 0.03
88 0.02
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.01
97 0.01
98 0.01
99 0.01
100 0.01
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.02
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.03
131 0.03
132 0.05
133 0.1
134 0.11
135 0.15
136 0.17
137 0.26
138 0.3
139 0.31
140 0.36
141 0.34
142 0.4
143 0.38
144 0.38
145 0.29
146 0.26
147 0.29
148 0.23
149 0.2
150 0.16
151 0.14
152 0.16
153 0.2
154 0.2
155 0.19
156 0.25
157 0.3
158 0.35
159 0.4
160 0.47
161 0.51
162 0.55
163 0.54
164 0.55
165 0.57
166 0.55
167 0.55
168 0.51
169 0.48
170 0.46
171 0.51
172 0.5
173 0.48
174 0.43
175 0.43
176 0.44
177 0.39
178 0.38
179 0.33
180 0.29
181 0.25
182 0.24
183 0.2
184 0.15
185 0.16
186 0.16
187 0.18
188 0.18
189 0.2
190 0.25
191 0.28
192 0.31
193 0.33
194 0.34
195 0.34
196 0.38
197 0.38
198 0.36
199 0.36
200 0.37
201 0.39
202 0.44
203 0.43
204 0.43
205 0.45
206 0.48
207 0.52
208 0.54
209 0.52
210 0.5
211 0.51
212 0.53
213 0.57
214 0.59
215 0.59
216 0.61
217 0.65
218 0.69
219 0.72
220 0.73
221 0.74
222 0.78
223 0.81
224 0.84
225 0.86
226 0.87
227 0.9
228 0.92
229 0.89
230 0.88
231 0.88
232 0.87
233 0.87
234 0.84
235 0.81