Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517L2S8

Protein Details
Accession A0A517L2S8   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
105-130RGDVRWVRKMWKKKVRSVGKERGLVIHydrophilic
NLS Segment(s)
PositionSequence
109-124RWVRKMWKKKVRSVGK
Subcellular Location(s) mito 23, nucl 2
Family & Domain DBs
Amino Acid Sequences MSPPPTTMAPPTHKKPKARTTFLSLPLEIRQNILLASDEHLKIPDYDHAKAAKLPYPSRLSAMDQWTSKKLVRLKYIELKDEELRRYKAEVIKWVNSLKGIKEIRGDVRWVRKMWKKKVRSVGKERGLVIWP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.72
3 0.75
4 0.78
5 0.78
6 0.74
7 0.73
8 0.74
9 0.74
10 0.68
11 0.58
12 0.5
13 0.45
14 0.44
15 0.34
16 0.27
17 0.2
18 0.16
19 0.16
20 0.14
21 0.12
22 0.09
23 0.11
24 0.13
25 0.13
26 0.13
27 0.14
28 0.14
29 0.13
30 0.14
31 0.17
32 0.17
33 0.18
34 0.2
35 0.21
36 0.21
37 0.23
38 0.23
39 0.22
40 0.22
41 0.22
42 0.24
43 0.27
44 0.27
45 0.27
46 0.27
47 0.25
48 0.26
49 0.28
50 0.26
51 0.23
52 0.24
53 0.24
54 0.24
55 0.22
56 0.23
57 0.24
58 0.26
59 0.31
60 0.33
61 0.37
62 0.43
63 0.45
64 0.43
65 0.4
66 0.38
67 0.36
68 0.37
69 0.35
70 0.32
71 0.31
72 0.29
73 0.29
74 0.31
75 0.31
76 0.3
77 0.35
78 0.35
79 0.37
80 0.39
81 0.38
82 0.34
83 0.32
84 0.31
85 0.23
86 0.27
87 0.25
88 0.23
89 0.26
90 0.29
91 0.31
92 0.31
93 0.34
94 0.31
95 0.4
96 0.44
97 0.42
98 0.47
99 0.51
100 0.6
101 0.67
102 0.71
103 0.7
104 0.74
105 0.83
106 0.85
107 0.87
108 0.87
109 0.86
110 0.84
111 0.82
112 0.73