Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M0L4

Protein Details
Accession E2M0L4    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
196-224SPDAKSIRFRKDKDKKSPKDKKDRLITASBasic
NLS Segment(s)
PositionSequence
200-223KSIRFRKDKDKKSPKDKKDRLITA
227-227K
230-236LNKAPKR
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
KEGG mpr:MPER_13198  -  
Amino Acid Sequences MSASPSASASASGPGSASEWADREPWLEETLTITAHCKECAAKPMLCIKQAACNQMTEQLRKTLPFRHVARCDRSYGAYTGAVEFLEEVIKVPGIKEPFHMGAFRHFVAEMDAVRAVDKAKAASDKAKVARSMYYPFYEYGSCVDNLIESKKQSKAADEDSGDDDVVVITNPSEDTEMIDASKGLNASMHAPKADSPDAKSIRFRKDKDKKSPKDKKDRLITASSIKSELNKAPKRPRLEHPVVDLREETIEERNSRVIGSASVNKYASLVPFLELEKAPVDVIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.13
5 0.11
6 0.12
7 0.14
8 0.15
9 0.14
10 0.15
11 0.16
12 0.17
13 0.17
14 0.16
15 0.15
16 0.17
17 0.17
18 0.16
19 0.14
20 0.14
21 0.16
22 0.17
23 0.17
24 0.16
25 0.17
26 0.2
27 0.28
28 0.31
29 0.28
30 0.31
31 0.4
32 0.43
33 0.42
34 0.4
35 0.33
36 0.37
37 0.4
38 0.41
39 0.32
40 0.3
41 0.29
42 0.35
43 0.38
44 0.33
45 0.31
46 0.31
47 0.31
48 0.32
49 0.34
50 0.33
51 0.34
52 0.39
53 0.41
54 0.45
55 0.53
56 0.58
57 0.63
58 0.58
59 0.57
60 0.5
61 0.48
62 0.41
63 0.33
64 0.28
65 0.22
66 0.2
67 0.17
68 0.16
69 0.13
70 0.1
71 0.09
72 0.07
73 0.06
74 0.05
75 0.05
76 0.05
77 0.06
78 0.06
79 0.06
80 0.09
81 0.11
82 0.11
83 0.12
84 0.16
85 0.17
86 0.18
87 0.19
88 0.16
89 0.19
90 0.21
91 0.2
92 0.17
93 0.15
94 0.14
95 0.15
96 0.15
97 0.11
98 0.09
99 0.09
100 0.09
101 0.09
102 0.09
103 0.08
104 0.07
105 0.08
106 0.07
107 0.08
108 0.1
109 0.11
110 0.14
111 0.16
112 0.2
113 0.23
114 0.25
115 0.25
116 0.24
117 0.25
118 0.24
119 0.25
120 0.22
121 0.2
122 0.18
123 0.18
124 0.18
125 0.16
126 0.14
127 0.12
128 0.12
129 0.1
130 0.09
131 0.08
132 0.08
133 0.08
134 0.1
135 0.11
136 0.1
137 0.13
138 0.15
139 0.19
140 0.19
141 0.21
142 0.22
143 0.24
144 0.27
145 0.25
146 0.25
147 0.23
148 0.23
149 0.2
150 0.16
151 0.12
152 0.08
153 0.07
154 0.05
155 0.03
156 0.03
157 0.03
158 0.03
159 0.04
160 0.05
161 0.04
162 0.06
163 0.07
164 0.07
165 0.07
166 0.07
167 0.07
168 0.06
169 0.07
170 0.06
171 0.05
172 0.05
173 0.06
174 0.1
175 0.13
176 0.14
177 0.13
178 0.13
179 0.15
180 0.19
181 0.23
182 0.2
183 0.2
184 0.28
185 0.31
186 0.32
187 0.39
188 0.4
189 0.46
190 0.53
191 0.53
192 0.56
193 0.64
194 0.72
195 0.76
196 0.81
197 0.81
198 0.84
199 0.92
200 0.91
201 0.92
202 0.9
203 0.88
204 0.87
205 0.84
206 0.78
207 0.72
208 0.65
209 0.61
210 0.56
211 0.48
212 0.39
213 0.32
214 0.29
215 0.28
216 0.31
217 0.34
218 0.37
219 0.45
220 0.54
221 0.61
222 0.67
223 0.69
224 0.71
225 0.71
226 0.73
227 0.69
228 0.66
229 0.69
230 0.61
231 0.58
232 0.5
233 0.41
234 0.33
235 0.3
236 0.23
237 0.19
238 0.23
239 0.22
240 0.23
241 0.24
242 0.23
243 0.22
244 0.22
245 0.17
246 0.15
247 0.19
248 0.26
249 0.26
250 0.3
251 0.3
252 0.29
253 0.29
254 0.28
255 0.24
256 0.19
257 0.17
258 0.14
259 0.16
260 0.17
261 0.2
262 0.18
263 0.19
264 0.16
265 0.16