Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517L756

Protein Details
Accession A0A517L756   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
80-102KDTIKCVYKKKGTPNHGNCENKPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 4, extr 15, mito 7
Family & Domain DBs
Amino Acid Sequences MRFTLIATTLFATALAQQQCLWEVHGVTAFVPVGGSVELNGVGVACGTTSEPNFGVGAKCKKAISQKAGTCDTFRYPKIKDTIKCVYKKKGTPNHGNCENKPSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.14
5 0.14
6 0.16
7 0.16
8 0.16
9 0.11
10 0.11
11 0.11
12 0.12
13 0.12
14 0.1
15 0.11
16 0.09
17 0.07
18 0.07
19 0.06
20 0.05
21 0.05
22 0.05
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.03
29 0.03
30 0.03
31 0.03
32 0.02
33 0.03
34 0.03
35 0.04
36 0.04
37 0.06
38 0.06
39 0.07
40 0.07
41 0.07
42 0.08
43 0.12
44 0.16
45 0.16
46 0.18
47 0.18
48 0.21
49 0.28
50 0.35
51 0.36
52 0.41
53 0.43
54 0.47
55 0.5
56 0.48
57 0.41
58 0.37
59 0.34
60 0.31
61 0.3
62 0.29
63 0.27
64 0.32
65 0.38
66 0.44
67 0.42
68 0.45
69 0.53
70 0.57
71 0.63
72 0.63
73 0.66
74 0.67
75 0.71
76 0.74
77 0.74
78 0.75
79 0.79
80 0.81
81 0.81
82 0.83
83 0.83
84 0.75