Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517L5X8

Protein Details
Accession A0A517L5X8   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
61-85SAPNVKVKATPRKRKAAKKEEANDGHydrophilic
NLS Segment(s)
PositionSequence
67-80VKATPRKRKAAKKE
94-98KKPKA
Subcellular Location(s) cyto 8, cyto_nucl 11, mito 4, nucl 12
Family & Domain DBs
Amino Acid Sequences MSGAGPRQDLQPNQDILPSHPSINSHINCPATYYVKRVNMSDIQNPSVKTEDTDDPAPSSSAPNVKVKATPRKRKAAKKEEANDGGDVEEGPTKKPKAAPKAGIPDRYEDLAAEDKMLLKMKEEGKGGKEIAEAWQTMTGNKHTSLGTRYVRIKAAIARVKDSDLEALERAMEKAKERIEEEKKVLEKRLWAFVAEGMETEGAEEKYDVPTLEKAWKRLQAEGKNGGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.35
3 0.31
4 0.35
5 0.31
6 0.25
7 0.24
8 0.25
9 0.27
10 0.35
11 0.33
12 0.3
13 0.33
14 0.34
15 0.32
16 0.34
17 0.33
18 0.29
19 0.29
20 0.31
21 0.34
22 0.39
23 0.4
24 0.38
25 0.4
26 0.4
27 0.43
28 0.45
29 0.41
30 0.37
31 0.39
32 0.38
33 0.35
34 0.31
35 0.27
36 0.21
37 0.22
38 0.22
39 0.23
40 0.24
41 0.23
42 0.22
43 0.22
44 0.21
45 0.17
46 0.16
47 0.14
48 0.16
49 0.18
50 0.22
51 0.23
52 0.23
53 0.27
54 0.33
55 0.41
56 0.48
57 0.56
58 0.59
59 0.68
60 0.75
61 0.81
62 0.85
63 0.85
64 0.83
65 0.83
66 0.81
67 0.79
68 0.74
69 0.66
70 0.55
71 0.44
72 0.35
73 0.25
74 0.19
75 0.11
76 0.1
77 0.08
78 0.09
79 0.13
80 0.13
81 0.15
82 0.2
83 0.26
84 0.33
85 0.39
86 0.42
87 0.45
88 0.54
89 0.57
90 0.57
91 0.51
92 0.45
93 0.39
94 0.35
95 0.29
96 0.19
97 0.16
98 0.13
99 0.13
100 0.1
101 0.09
102 0.09
103 0.1
104 0.11
105 0.09
106 0.08
107 0.13
108 0.14
109 0.18
110 0.19
111 0.19
112 0.19
113 0.22
114 0.22
115 0.17
116 0.16
117 0.13
118 0.13
119 0.13
120 0.12
121 0.1
122 0.12
123 0.11
124 0.12
125 0.13
126 0.13
127 0.13
128 0.14
129 0.15
130 0.13
131 0.15
132 0.16
133 0.21
134 0.22
135 0.25
136 0.27
137 0.28
138 0.29
139 0.28
140 0.27
141 0.24
142 0.31
143 0.31
144 0.29
145 0.29
146 0.29
147 0.29
148 0.28
149 0.25
150 0.18
151 0.14
152 0.15
153 0.12
154 0.11
155 0.11
156 0.11
157 0.11
158 0.12
159 0.12
160 0.13
161 0.17
162 0.2
163 0.23
164 0.25
165 0.34
166 0.37
167 0.42
168 0.44
169 0.46
170 0.49
171 0.49
172 0.5
173 0.43
174 0.43
175 0.4
176 0.45
177 0.38
178 0.34
179 0.31
180 0.3
181 0.29
182 0.22
183 0.19
184 0.12
185 0.12
186 0.11
187 0.1
188 0.11
189 0.09
190 0.09
191 0.1
192 0.09
193 0.11
194 0.13
195 0.13
196 0.13
197 0.15
198 0.17
199 0.26
200 0.29
201 0.33
202 0.39
203 0.45
204 0.45
205 0.51
206 0.58
207 0.57
208 0.61