Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517LNV1

Protein Details
Accession A0A517LNV1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
28-50TTTTTTRRTPRSKRHVNNFNTTTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
Amino Acid Sequences MARTTTTRRPGLLARLRGAPKTVTTTHTTTTTTRRTPRSKRHVNNFNTTTGAPVQHHRRKVSMGDKVSGAMMRLRGSLTRRPGLKAAGTRRMHGTDGRGAHHVAAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.5
4 0.48
5 0.45
6 0.36
7 0.3
8 0.3
9 0.29
10 0.25
11 0.28
12 0.29
13 0.29
14 0.29
15 0.29
16 0.26
17 0.31
18 0.34
19 0.35
20 0.39
21 0.45
22 0.53
23 0.6
24 0.68
25 0.72
26 0.77
27 0.79
28 0.83
29 0.85
30 0.8
31 0.8
32 0.72
33 0.62
34 0.53
35 0.44
36 0.35
37 0.26
38 0.22
39 0.14
40 0.17
41 0.25
42 0.28
43 0.33
44 0.33
45 0.33
46 0.34
47 0.4
48 0.42
49 0.4
50 0.37
51 0.35
52 0.33
53 0.32
54 0.31
55 0.25
56 0.18
57 0.11
58 0.11
59 0.1
60 0.1
61 0.1
62 0.13
63 0.17
64 0.23
65 0.27
66 0.32
67 0.33
68 0.35
69 0.37
70 0.37
71 0.39
72 0.41
73 0.42
74 0.47
75 0.47
76 0.46
77 0.48
78 0.47
79 0.44
80 0.39
81 0.36
82 0.33
83 0.34
84 0.34
85 0.32
86 0.3