Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4R256

Protein Details
Accession C4R256    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
15-40AAMAGSKKSKKKWSKGKVKDKAQHAVHydrophilic
NLS Segment(s)
PositionSequence
12-35KAAAAMAGSKKSKKKWSKGKVKDK
Subcellular Location(s) mito 16, nucl 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG ppa:PAS_chr2-2_0326  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKIQQSKAAKAAAAMAGSKKSKKKWSKGKVKDKAQHAVILEQDKYDRIMKEVPTYRYVSVSVLVDRLKIGGSMARVALRQLENDGVIKPVLLHSKQQIYTRATASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.27
3 0.2
4 0.15
5 0.18
6 0.21
7 0.27
8 0.3
9 0.35
10 0.45
11 0.53
12 0.62
13 0.68
14 0.76
15 0.82
16 0.87
17 0.91
18 0.91
19 0.92
20 0.88
21 0.83
22 0.79
23 0.7
24 0.62
25 0.52
26 0.43
27 0.36
28 0.31
29 0.25
30 0.18
31 0.17
32 0.14
33 0.15
34 0.16
35 0.13
36 0.12
37 0.15
38 0.16
39 0.22
40 0.27
41 0.28
42 0.28
43 0.3
44 0.28
45 0.26
46 0.26
47 0.19
48 0.15
49 0.14
50 0.11
51 0.11
52 0.11
53 0.1
54 0.09
55 0.09
56 0.08
57 0.07
58 0.07
59 0.06
60 0.07
61 0.08
62 0.09
63 0.1
64 0.1
65 0.1
66 0.14
67 0.13
68 0.13
69 0.14
70 0.14
71 0.14
72 0.15
73 0.16
74 0.12
75 0.12
76 0.11
77 0.09
78 0.12
79 0.17
80 0.17
81 0.21
82 0.25
83 0.33
84 0.37
85 0.42
86 0.46
87 0.44
88 0.47