Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517LMZ6

Protein Details
Accession A0A517LMZ6    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
24-63VKPVPKAKSTSKKPSQKASTKRKPRVTKTKSRRFKPNSFWHydrophilic
NLS Segment(s)
PositionSequence
26-58PVPKAKSTSKKPSQKASTKRKPRVTKTKSRRFK
131-137KKWFKRG
Subcellular Location(s) mito 13mito_nucl 13, nucl 11
Family & Domain DBs
Amino Acid Sequences MATSKPKSTAKAEALTKTKTTLTVKPVPKAKSTSKKPSQKASTKRKPRVTKTKSRRFKPNSFWGLPTELRQLTLFYTYTDRDMEKSICRRWGEARLIFGSHYFDTEYLEDWTLLLMDVGSKVRKETEFVRKKWFKRGWELARAKDNGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.54
3 0.49
4 0.43
5 0.38
6 0.36
7 0.36
8 0.34
9 0.36
10 0.42
11 0.46
12 0.51
13 0.57
14 0.54
15 0.54
16 0.55
17 0.58
18 0.59
19 0.63
20 0.67
21 0.7
22 0.77
23 0.77
24 0.81
25 0.81
26 0.8
27 0.82
28 0.82
29 0.83
30 0.84
31 0.88
32 0.88
33 0.88
34 0.88
35 0.89
36 0.87
37 0.87
38 0.87
39 0.88
40 0.88
41 0.84
42 0.85
43 0.82
44 0.82
45 0.8
46 0.79
47 0.76
48 0.68
49 0.64
50 0.54
51 0.5
52 0.42
53 0.35
54 0.28
55 0.2
56 0.19
57 0.18
58 0.16
59 0.13
60 0.14
61 0.12
62 0.09
63 0.11
64 0.1
65 0.11
66 0.12
67 0.12
68 0.11
69 0.13
70 0.14
71 0.18
72 0.23
73 0.24
74 0.29
75 0.29
76 0.3
77 0.32
78 0.38
79 0.39
80 0.36
81 0.37
82 0.32
83 0.32
84 0.3
85 0.27
86 0.22
87 0.15
88 0.14
89 0.11
90 0.1
91 0.12
92 0.12
93 0.13
94 0.11
95 0.12
96 0.11
97 0.1
98 0.1
99 0.08
100 0.07
101 0.06
102 0.04
103 0.04
104 0.05
105 0.08
106 0.09
107 0.09
108 0.1
109 0.14
110 0.15
111 0.18
112 0.25
113 0.34
114 0.42
115 0.45
116 0.56
117 0.61
118 0.64
119 0.72
120 0.71
121 0.67
122 0.68
123 0.76
124 0.73
125 0.75
126 0.79
127 0.75
128 0.76