Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A517LNT0

Protein Details
Accession A0A517LNT0    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKIAKPKKKASLHSRAARRAEHydrophilic
53-79HNSGIRKKKAKPLKRSQKIRQQKGIERBasic
NLS Segment(s)
PositionSequence
5-20AKPKKKASLHSRAARR
57-75IRKKKAKPLKRSQKIRQQK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MGKIAKPKKKASLHSRAARRAESPSLNIDKSLKTIKPPESNPHVHIFSNSAVHNSGIRKKKAKPLKRSQKIRQQKGIERADIVKEQNDTKLVKSLDKLRTVKERAKAWETLNPKLEKVDGVTRSSAPSKFAALDDEMWEDVEDKAAPENVDTTLPKPGLVIDLPMHLPPADIPLPAEEEDEIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.83
4 0.79
5 0.72
6 0.64
7 0.58
8 0.55
9 0.49
10 0.42
11 0.42
12 0.42
13 0.39
14 0.39
15 0.35
16 0.29
17 0.3
18 0.33
19 0.27
20 0.27
21 0.34
22 0.41
23 0.46
24 0.5
25 0.54
26 0.56
27 0.59
28 0.57
29 0.56
30 0.5
31 0.42
32 0.39
33 0.33
34 0.26
35 0.25
36 0.22
37 0.17
38 0.15
39 0.16
40 0.18
41 0.19
42 0.25
43 0.29
44 0.34
45 0.38
46 0.42
47 0.51
48 0.59
49 0.65
50 0.68
51 0.71
52 0.78
53 0.83
54 0.88
55 0.88
56 0.88
57 0.89
58 0.87
59 0.85
60 0.8
61 0.77
62 0.77
63 0.72
64 0.61
65 0.52
66 0.45
67 0.38
68 0.34
69 0.27
70 0.19
71 0.16
72 0.16
73 0.16
74 0.17
75 0.15
76 0.13
77 0.18
78 0.17
79 0.17
80 0.18
81 0.25
82 0.27
83 0.34
84 0.35
85 0.33
86 0.4
87 0.44
88 0.47
89 0.44
90 0.44
91 0.41
92 0.43
93 0.44
94 0.38
95 0.4
96 0.39
97 0.38
98 0.4
99 0.36
100 0.33
101 0.3
102 0.28
103 0.22
104 0.21
105 0.23
106 0.19
107 0.2
108 0.22
109 0.22
110 0.24
111 0.26
112 0.24
113 0.19
114 0.17
115 0.17
116 0.16
117 0.16
118 0.16
119 0.15
120 0.15
121 0.14
122 0.15
123 0.14
124 0.13
125 0.12
126 0.11
127 0.09
128 0.09
129 0.08
130 0.07
131 0.08
132 0.1
133 0.1
134 0.09
135 0.11
136 0.1
137 0.13
138 0.14
139 0.14
140 0.18
141 0.18
142 0.18
143 0.17
144 0.16
145 0.16
146 0.16
147 0.17
148 0.12
149 0.15
150 0.16
151 0.16
152 0.17
153 0.14
154 0.14
155 0.11
156 0.16
157 0.14
158 0.13
159 0.14
160 0.15
161 0.18
162 0.19
163 0.19