Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A517LAS4

Protein Details
Accession A0A517LAS4    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
19-46DAVSARIKKNKKTQKIKFKVRCKRYLYTHydrophilic
66-85LSISDTPKKNQKGKRTAKTSHydrophilic
NLS Segment(s)
PositionSequence
23-37ARIKKNKKTQKIKFK
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPAEVTDIKKFIEICRRKDAVSARIKKNKKTQKIKFKVRCKRYLYTLVLKDSDRAEKLKQSLPPGLSISDTPKKNQKGKRTAKTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.47
3 0.48
4 0.46
5 0.51
6 0.52
7 0.51
8 0.54
9 0.57
10 0.58
11 0.66
12 0.7
13 0.71
14 0.75
15 0.76
16 0.76
17 0.78
18 0.79
19 0.81
20 0.87
21 0.9
22 0.9
23 0.9
24 0.9
25 0.87
26 0.86
27 0.81
28 0.74
29 0.68
30 0.67
31 0.6
32 0.58
33 0.53
34 0.46
35 0.42
36 0.38
37 0.34
38 0.28
39 0.27
40 0.21
41 0.2
42 0.19
43 0.22
44 0.26
45 0.29
46 0.31
47 0.32
48 0.35
49 0.34
50 0.35
51 0.32
52 0.29
53 0.25
54 0.23
55 0.26
56 0.28
57 0.29
58 0.31
59 0.38
60 0.46
61 0.54
62 0.61
63 0.64
64 0.68
65 0.77