Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A517L9P1

Protein Details
Accession A0A517L9P1    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-35NLVKKVFRGIFKKKDKKSKTEEPATAHydrophilic
NLS Segment(s)
PositionSequence
20-27FKKKDKKS
Subcellular Location(s) mito 11.5, cyto 10.5, mito_nucl 8.833, cyto_nucl 8.333, nucl 5
Family & Domain DBs
Amino Acid Sequences MPGVPPDAVNLVKKVFRGIFKKKDKKSKTEEPATASVTEPTKTETAPTETAPPPAAPATTPAVPADAKPAESTPAVEPKAPTPAAEPKIPTPAVEPEAPAETAPAAATISSVAPTSTTAALAGEVPKEAHAPTPAPAVEAPKEAAAAPTETPTVPEPTPAAPEVKPEEVKPEAPAAPTEGAMSATSGPLSDELNLATH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.32
4 0.39
5 0.47
6 0.55
7 0.64
8 0.74
9 0.78
10 0.85
11 0.85
12 0.85
13 0.85
14 0.85
15 0.84
16 0.83
17 0.78
18 0.73
19 0.7
20 0.62
21 0.54
22 0.44
23 0.37
24 0.29
25 0.25
26 0.19
27 0.18
28 0.16
29 0.15
30 0.16
31 0.16
32 0.19
33 0.21
34 0.21
35 0.24
36 0.24
37 0.26
38 0.25
39 0.22
40 0.19
41 0.17
42 0.17
43 0.11
44 0.13
45 0.14
46 0.14
47 0.15
48 0.13
49 0.14
50 0.14
51 0.14
52 0.16
53 0.13
54 0.13
55 0.13
56 0.13
57 0.14
58 0.14
59 0.16
60 0.12
61 0.18
62 0.18
63 0.18
64 0.18
65 0.18
66 0.22
67 0.2
68 0.18
69 0.16
70 0.23
71 0.24
72 0.25
73 0.25
74 0.22
75 0.26
76 0.26
77 0.23
78 0.18
79 0.18
80 0.18
81 0.17
82 0.16
83 0.12
84 0.13
85 0.13
86 0.11
87 0.08
88 0.06
89 0.06
90 0.05
91 0.04
92 0.03
93 0.03
94 0.03
95 0.03
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.05
102 0.06
103 0.06
104 0.06
105 0.06
106 0.06
107 0.06
108 0.06
109 0.07
110 0.05
111 0.06
112 0.06
113 0.06
114 0.07
115 0.07
116 0.08
117 0.09
118 0.1
119 0.1
120 0.14
121 0.13
122 0.14
123 0.14
124 0.16
125 0.15
126 0.16
127 0.16
128 0.12
129 0.13
130 0.12
131 0.12
132 0.1
133 0.1
134 0.09
135 0.1
136 0.11
137 0.1
138 0.12
139 0.13
140 0.16
141 0.14
142 0.15
143 0.16
144 0.16
145 0.19
146 0.19
147 0.2
148 0.16
149 0.21
150 0.24
151 0.27
152 0.28
153 0.25
154 0.3
155 0.3
156 0.31
157 0.29
158 0.28
159 0.25
160 0.24
161 0.25
162 0.22
163 0.2
164 0.19
165 0.18
166 0.14
167 0.13
168 0.12
169 0.13
170 0.1
171 0.09
172 0.09
173 0.08
174 0.08
175 0.08
176 0.09
177 0.09
178 0.09