Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517LR46

Protein Details
Accession A0A517LR46    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-23DAFVSRKRRRVSPETKIKPDINHydrophilic
386-406ATVLRCVQRKKENRGRYMWMCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, nucl 11, cyto_mito 8.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027450  AlkB-like  
IPR037151  AlkB-like_sf  
IPR032854  ALKBH3  
IPR005123  Oxoglu/Fe-dep_dioxygenase  
IPR010666  Znf_GRF  
Gene Ontology GO:0051213  F:dioxygenase activity  
GO:0008270  F:zinc ion binding  
GO:0006307  P:DNA dealkylation involved in DNA repair  
GO:0035552  P:oxidative single-stranded DNA demethylation  
Pfam View protein in Pfam  
PF13532  2OG-FeII_Oxy_2  
PF06839  zf-GRF  
PROSITE View protein in PROSITE  
PS51471  FE2OG_OXY  
PS51999  ZF_GRF  
CDD cd14279  CUE  
Amino Acid Sequences MDAFVSRKRRRVSPETKIKPDINPPLVANEQDDDSTDFKLAMLASLYSDLDHGLLLDILLAANGSVEAALENLGKDPRTSSKKQSTSGMGHQASLASFDIGSGSTKKQTLTKKGKTLHLYAPEDIAAHTPCSIIHNFLEKGEADALLRELLEEAPTFQRERFKMFDRVVESPHTMCFYVDSEDEAEIQRTQYVYMGDRIADVRPSLPKMREVSSKVQVAVNAENERRIRDFYPGGKKLRFQSPDEWKPNAAFVNCYDGGQESVGYHADQLTYLGPRAIIGSLSLGVSREFRVRKIISKDEEEPSTKARKKDDTIADAEGQIAIHLPHNSLLVMHAEMQEEWKHSIAPAQAIDPHPIAKNKRLNITYRWYKDALHPKYTPKCRCGIATVLRCVQRKKENRGRYMWMCHANYTPGKEGCSFFQWAEFDDDGNPPWKDATKEETRSCELKKPCQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.85
4 0.84
5 0.79
6 0.74
7 0.73
8 0.72
9 0.65
10 0.59
11 0.51
12 0.5
13 0.48
14 0.43
15 0.36
16 0.27
17 0.24
18 0.2
19 0.21
20 0.18
21 0.17
22 0.17
23 0.15
24 0.14
25 0.12
26 0.14
27 0.12
28 0.1
29 0.1
30 0.09
31 0.09
32 0.11
33 0.11
34 0.09
35 0.09
36 0.09
37 0.08
38 0.07
39 0.06
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.04
46 0.04
47 0.04
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.05
57 0.05
58 0.06
59 0.08
60 0.1
61 0.1
62 0.11
63 0.14
64 0.22
65 0.29
66 0.34
67 0.42
68 0.51
69 0.57
70 0.6
71 0.62
72 0.6
73 0.59
74 0.6
75 0.6
76 0.5
77 0.44
78 0.41
79 0.36
80 0.28
81 0.24
82 0.18
83 0.09
84 0.08
85 0.07
86 0.08
87 0.07
88 0.09
89 0.09
90 0.11
91 0.14
92 0.15
93 0.17
94 0.23
95 0.3
96 0.4
97 0.48
98 0.55
99 0.6
100 0.65
101 0.71
102 0.7
103 0.67
104 0.63
105 0.62
106 0.57
107 0.49
108 0.44
109 0.37
110 0.32
111 0.27
112 0.22
113 0.14
114 0.11
115 0.1
116 0.09
117 0.09
118 0.12
119 0.12
120 0.12
121 0.13
122 0.18
123 0.18
124 0.18
125 0.2
126 0.16
127 0.18
128 0.16
129 0.15
130 0.09
131 0.09
132 0.1
133 0.08
134 0.08
135 0.06
136 0.06
137 0.06
138 0.06
139 0.06
140 0.07
141 0.09
142 0.11
143 0.12
144 0.13
145 0.2
146 0.2
147 0.24
148 0.27
149 0.3
150 0.36
151 0.36
152 0.4
153 0.37
154 0.38
155 0.36
156 0.34
157 0.31
158 0.24
159 0.24
160 0.2
161 0.16
162 0.14
163 0.13
164 0.11
165 0.11
166 0.11
167 0.11
168 0.1
169 0.1
170 0.11
171 0.1
172 0.1
173 0.09
174 0.09
175 0.08
176 0.08
177 0.08
178 0.08
179 0.09
180 0.09
181 0.11
182 0.11
183 0.1
184 0.11
185 0.12
186 0.11
187 0.1
188 0.09
189 0.08
190 0.1
191 0.13
192 0.16
193 0.16
194 0.2
195 0.22
196 0.24
197 0.28
198 0.31
199 0.34
200 0.35
201 0.36
202 0.32
203 0.3
204 0.28
205 0.25
206 0.22
207 0.2
208 0.18
209 0.16
210 0.19
211 0.19
212 0.19
213 0.18
214 0.19
215 0.16
216 0.17
217 0.2
218 0.24
219 0.33
220 0.37
221 0.4
222 0.39
223 0.41
224 0.42
225 0.47
226 0.43
227 0.37
228 0.4
229 0.46
230 0.54
231 0.56
232 0.54
233 0.46
234 0.43
235 0.42
236 0.35
237 0.26
238 0.17
239 0.13
240 0.18
241 0.18
242 0.17
243 0.16
244 0.13
245 0.14
246 0.13
247 0.12
248 0.05
249 0.06
250 0.07
251 0.06
252 0.06
253 0.06
254 0.06
255 0.05
256 0.06
257 0.06
258 0.06
259 0.07
260 0.07
261 0.06
262 0.06
263 0.07
264 0.07
265 0.05
266 0.05
267 0.05
268 0.06
269 0.06
270 0.06
271 0.06
272 0.06
273 0.07
274 0.08
275 0.13
276 0.14
277 0.15
278 0.22
279 0.24
280 0.3
281 0.36
282 0.42
283 0.41
284 0.45
285 0.48
286 0.44
287 0.46
288 0.42
289 0.37
290 0.33
291 0.39
292 0.38
293 0.38
294 0.39
295 0.42
296 0.44
297 0.51
298 0.54
299 0.49
300 0.48
301 0.47
302 0.43
303 0.36
304 0.33
305 0.24
306 0.16
307 0.11
308 0.08
309 0.06
310 0.07
311 0.08
312 0.08
313 0.09
314 0.09
315 0.09
316 0.09
317 0.09
318 0.09
319 0.09
320 0.1
321 0.1
322 0.1
323 0.11
324 0.13
325 0.14
326 0.14
327 0.15
328 0.14
329 0.13
330 0.12
331 0.16
332 0.16
333 0.17
334 0.16
335 0.15
336 0.2
337 0.21
338 0.24
339 0.21
340 0.21
341 0.22
342 0.27
343 0.3
344 0.34
345 0.41
346 0.42
347 0.5
348 0.52
349 0.54
350 0.54
351 0.6
352 0.61
353 0.58
354 0.58
355 0.51
356 0.48
357 0.53
358 0.57
359 0.53
360 0.5
361 0.5
362 0.55
363 0.64
364 0.72
365 0.7
366 0.64
367 0.62
368 0.58
369 0.57
370 0.52
371 0.51
372 0.5
373 0.5
374 0.52
375 0.53
376 0.56
377 0.58
378 0.57
379 0.56
380 0.57
381 0.59
382 0.65
383 0.69
384 0.73
385 0.77
386 0.8
387 0.81
388 0.78
389 0.76
390 0.73
391 0.72
392 0.63
393 0.58
394 0.53
395 0.51
396 0.48
397 0.44
398 0.43
399 0.35
400 0.37
401 0.37
402 0.37
403 0.34
404 0.34
405 0.32
406 0.25
407 0.28
408 0.26
409 0.25
410 0.3
411 0.26
412 0.23
413 0.22
414 0.24
415 0.21
416 0.26
417 0.24
418 0.19
419 0.21
420 0.23
421 0.24
422 0.27
423 0.33
424 0.37
425 0.45
426 0.5
427 0.55
428 0.57
429 0.6
430 0.59
431 0.6
432 0.58