Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517LMJ1

Protein Details
Accession A0A517LMJ1    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
67-89YETQERKAAEKKKEKEREKTVLGBasic
NLS Segment(s)
PositionSequence
73-84KAAEKKKEKERE
Subcellular Location(s) nucl 12.5, cyto_nucl 9.833, mito 7.5, cyto_mito 7.333, cyto 6
Family & Domain DBs
Amino Acid Sequences MQSTTFCFLCTQPLPYHVLLLHWEIDHGHPYNPDLVQPQVLSLHQQQQQQQMEFYEAYVSTARWRHYETQERKAAEKKKEKEREKTVLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.29
4 0.22
5 0.21
6 0.19
7 0.19
8 0.18
9 0.13
10 0.13
11 0.12
12 0.13
13 0.15
14 0.15
15 0.14
16 0.13
17 0.14
18 0.16
19 0.15
20 0.15
21 0.13
22 0.12
23 0.12
24 0.12
25 0.11
26 0.1
27 0.1
28 0.11
29 0.11
30 0.17
31 0.2
32 0.23
33 0.25
34 0.32
35 0.35
36 0.33
37 0.32
38 0.26
39 0.24
40 0.21
41 0.18
42 0.12
43 0.08
44 0.09
45 0.09
46 0.09
47 0.11
48 0.14
49 0.16
50 0.17
51 0.21
52 0.26
53 0.34
54 0.45
55 0.48
56 0.54
57 0.59
58 0.59
59 0.6
60 0.62
61 0.62
62 0.61
63 0.65
64 0.64
65 0.68
66 0.77
67 0.82
68 0.84
69 0.85