Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A517LF99

Protein Details
Accession A0A517LF99    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
103-135QPLFAQPKPKKESRRRSSAKKVRRTSKPMSPIAHydrophilic
NLS Segment(s)
PositionSequence
109-129PKPKKESRRRSSAKKVRRTSK
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MNFSYSPSSSASSSPISIGWPSPSGSESSSPRSIPAASKSNMACAYPSWPTGPALSPYTTGAPSAFISDEDLFLDELLDGEAPFLREAPAPPRDIPLPAMPLQPLFAQPKPKKESRRRSSAKKVRRTSKPMSPIAESPEMQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.16
4 0.16
5 0.16
6 0.15
7 0.14
8 0.15
9 0.15
10 0.15
11 0.15
12 0.16
13 0.19
14 0.2
15 0.25
16 0.27
17 0.26
18 0.26
19 0.27
20 0.26
21 0.25
22 0.27
23 0.28
24 0.26
25 0.3
26 0.29
27 0.32
28 0.31
29 0.28
30 0.23
31 0.17
32 0.19
33 0.16
34 0.17
35 0.13
36 0.13
37 0.14
38 0.14
39 0.15
40 0.14
41 0.15
42 0.15
43 0.15
44 0.15
45 0.15
46 0.14
47 0.13
48 0.1
49 0.09
50 0.09
51 0.09
52 0.08
53 0.07
54 0.09
55 0.09
56 0.09
57 0.08
58 0.08
59 0.07
60 0.07
61 0.07
62 0.04
63 0.04
64 0.04
65 0.04
66 0.03
67 0.03
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05
73 0.06
74 0.07
75 0.12
76 0.15
77 0.17
78 0.18
79 0.2
80 0.2
81 0.21
82 0.22
83 0.19
84 0.2
85 0.19
86 0.2
87 0.18
88 0.17
89 0.17
90 0.15
91 0.17
92 0.18
93 0.19
94 0.29
95 0.32
96 0.42
97 0.47
98 0.54
99 0.61
100 0.68
101 0.76
102 0.74
103 0.82
104 0.82
105 0.85
106 0.89
107 0.89
108 0.88
109 0.88
110 0.89
111 0.88
112 0.89
113 0.87
114 0.84
115 0.83
116 0.82
117 0.78
118 0.73
119 0.67
120 0.6
121 0.59
122 0.56