Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517LH68

Protein Details
Accession A0A517LH68    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
20-48PFKFCLSKLKTRLRSSKKPKTPRISTPIPHydrophilic
NLS Segment(s)
PositionSequence
31-39RLRSSKKPK
Subcellular Location(s) mito 23.5, cyto_mito 13.333, cyto_nucl 2.333
Family & Domain DBs
Amino Acid Sequences MALTKTKQHLSSISKAIKAPFKFCLSKLKTRLRSSKKPKTPRISTPIPLTTMYNVESEKMAPPISPPASVAPSDDTIIHHEVSLQTTPSRPASEPMLFDMDDDLEQVGEGESVIVEEVPRHSISNIKWGPSRVEGVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.48
3 0.5
4 0.5
5 0.46
6 0.42
7 0.38
8 0.41
9 0.4
10 0.4
11 0.46
12 0.45
13 0.52
14 0.58
15 0.63
16 0.65
17 0.71
18 0.8
19 0.78
20 0.83
21 0.84
22 0.86
23 0.86
24 0.87
25 0.89
26 0.88
27 0.86
28 0.84
29 0.81
30 0.77
31 0.7
32 0.66
33 0.58
34 0.5
35 0.43
36 0.35
37 0.28
38 0.23
39 0.2
40 0.15
41 0.13
42 0.11
43 0.11
44 0.11
45 0.1
46 0.1
47 0.09
48 0.08
49 0.08
50 0.13
51 0.13
52 0.13
53 0.12
54 0.13
55 0.14
56 0.14
57 0.14
58 0.11
59 0.11
60 0.11
61 0.11
62 0.1
63 0.12
64 0.13
65 0.12
66 0.1
67 0.1
68 0.1
69 0.12
70 0.12
71 0.1
72 0.09
73 0.1
74 0.12
75 0.13
76 0.15
77 0.14
78 0.15
79 0.2
80 0.21
81 0.22
82 0.22
83 0.22
84 0.2
85 0.19
86 0.18
87 0.13
88 0.11
89 0.1
90 0.08
91 0.05
92 0.05
93 0.05
94 0.05
95 0.04
96 0.04
97 0.03
98 0.03
99 0.03
100 0.04
101 0.04
102 0.03
103 0.05
104 0.06
105 0.09
106 0.1
107 0.11
108 0.12
109 0.17
110 0.19
111 0.29
112 0.3
113 0.31
114 0.34
115 0.36
116 0.4
117 0.38