Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517LH68

Protein Details
Accession A0A517LH68   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
20-48PFKFCLSKLKTRLRSSKKPKTPRISTPIPHydrophilic
NLS Segment(s)
PositionSequence
31-39RLRSSKKPK
Subcellular Location(s) cyto_mito 13.333, cyto_nucl 2.333, mito 23.5
Family & Domain DBs
Amino Acid Sequences MALTKTKQHLSSISKAIKAPFKFCLSKLKTRLRSSKKPKTPRISTPIPLTTMYNVESEKMAPPISPPASVAPSDDTIIHHEVSLQTTPSRPASEPMLFDMDDDLEQVGEGESVIVEEVPRHSISNIKWGPSRVEGVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.48
3 0.5
4 0.5
5 0.46
6 0.42
7 0.38
8 0.41
9 0.4
10 0.4
11 0.46
12 0.45
13 0.52
14 0.58
15 0.63
16 0.65
17 0.71
18 0.8
19 0.78
20 0.83
21 0.84
22 0.86
23 0.86
24 0.87
25 0.89
26 0.88
27 0.86
28 0.84
29 0.81
30 0.77
31 0.7
32 0.66
33 0.58
34 0.5
35 0.43
36 0.35
37 0.28
38 0.23
39 0.2
40 0.15
41 0.13
42 0.11
43 0.11
44 0.11
45 0.1
46 0.1
47 0.09
48 0.08
49 0.08
50 0.13
51 0.13
52 0.13
53 0.12
54 0.13
55 0.14
56 0.14
57 0.14
58 0.11
59 0.11
60 0.11
61 0.11
62 0.1
63 0.12
64 0.13
65 0.12
66 0.1
67 0.1
68 0.1
69 0.12
70 0.12
71 0.1
72 0.09
73 0.1
74 0.12
75 0.13
76 0.15
77 0.14
78 0.15
79 0.2
80 0.21
81 0.22
82 0.22
83 0.22
84 0.2
85 0.19
86 0.18
87 0.13
88 0.11
89 0.1
90 0.08
91 0.05
92 0.05
93 0.05
94 0.05
95 0.04
96 0.04
97 0.03
98 0.03
99 0.03
100 0.04
101 0.04
102 0.03
103 0.05
104 0.06
105 0.09
106 0.1
107 0.11
108 0.12
109 0.17
110 0.19
111 0.29
112 0.3
113 0.31
114 0.34
115 0.36
116 0.4
117 0.38