Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517L9L7

Protein Details
Accession A0A517L9L7   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
173-204KYKIKESRARRQARVYKEKRMRKSRSPMASGEHydrophilic
NLS Segment(s)
PositionSequence
173-213KYKIKESRARRQARVYKEKRMRKSRSPMASGEGRPRKIFRR
Subcellular Location(s) cyto 3, cyto_nucl 13, nucl 21
Family & Domain DBs
Amino Acid Sequences MSLKAEDASKREHDFPKLDHDGSNFIEQRAIYGDQIRREAGVQRFYRELPFHMTPSLKTLHPSIENDPWDNFASPTEKTRESHELLIPLLLYLSLHPCKAISSLAPPMERYCLTPSFSLPRYRSFTPLTIKQPPASSNEALSAIGTPNFFLEVDDAVDMDEERSLQLELERLKYKIKESRARRQARVYKEKRMRKSRSPMASGEGRPRKIFRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.5
4 0.51
5 0.48
6 0.43
7 0.4
8 0.38
9 0.36
10 0.42
11 0.33
12 0.27
13 0.28
14 0.25
15 0.25
16 0.24
17 0.23
18 0.16
19 0.22
20 0.25
21 0.26
22 0.29
23 0.28
24 0.25
25 0.25
26 0.3
27 0.29
28 0.34
29 0.32
30 0.33
31 0.35
32 0.35
33 0.39
34 0.33
35 0.3
36 0.29
37 0.29
38 0.28
39 0.29
40 0.29
41 0.25
42 0.26
43 0.27
44 0.2
45 0.19
46 0.19
47 0.2
48 0.22
49 0.24
50 0.26
51 0.29
52 0.31
53 0.31
54 0.3
55 0.28
56 0.26
57 0.24
58 0.2
59 0.15
60 0.15
61 0.14
62 0.17
63 0.18
64 0.19
65 0.19
66 0.24
67 0.28
68 0.28
69 0.31
70 0.29
71 0.27
72 0.25
73 0.24
74 0.19
75 0.13
76 0.1
77 0.06
78 0.05
79 0.04
80 0.08
81 0.08
82 0.08
83 0.08
84 0.08
85 0.09
86 0.1
87 0.1
88 0.07
89 0.09
90 0.13
91 0.15
92 0.15
93 0.15
94 0.15
95 0.17
96 0.16
97 0.15
98 0.15
99 0.15
100 0.16
101 0.16
102 0.17
103 0.2
104 0.22
105 0.27
106 0.25
107 0.28
108 0.32
109 0.32
110 0.35
111 0.33
112 0.35
113 0.34
114 0.39
115 0.39
116 0.41
117 0.41
118 0.39
119 0.39
120 0.35
121 0.35
122 0.33
123 0.27
124 0.21
125 0.21
126 0.2
127 0.18
128 0.17
129 0.13
130 0.09
131 0.09
132 0.08
133 0.07
134 0.06
135 0.07
136 0.07
137 0.07
138 0.07
139 0.06
140 0.07
141 0.07
142 0.07
143 0.06
144 0.06
145 0.06
146 0.05
147 0.05
148 0.04
149 0.04
150 0.05
151 0.06
152 0.06
153 0.06
154 0.1
155 0.12
156 0.18
157 0.21
158 0.21
159 0.25
160 0.27
161 0.34
162 0.37
163 0.44
164 0.49
165 0.55
166 0.65
167 0.71
168 0.77
169 0.76
170 0.79
171 0.78
172 0.79
173 0.82
174 0.78
175 0.78
176 0.8
177 0.84
178 0.84
179 0.86
180 0.84
181 0.83
182 0.88
183 0.86
184 0.86
185 0.81
186 0.73
187 0.68
188 0.68
189 0.62
190 0.62
191 0.61
192 0.56
193 0.55