Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A517LGZ7

Protein Details
Accession A0A517LGZ7    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
117-142KELNKELRTQSKKRKRDSLLQHAMKRHydrophilic
155-176SQPPPPPVDRPKKKSERVSWLPHydrophilic
NLS Segment(s)
PositionSequence
128-132KKRKR
166-167KK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008895  Vps72/YL1  
IPR013272  Vps72/YL1_C  
IPR046757  YL1_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0140849  F:ATP-dependent H2AZ histone chaperone activity  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF05764  YL1  
PF08265  YL1_C  
Amino Acid Sequences MSNNGESDIPMPDTPAQDDAGSERHERDSSEDEQVPAMVVTREKRKNAGNRMSKLLALARDEGPEPDDEEEELAGIFQEAVDDVEFEGEEGDDQDFNMDSSSEDEAEGDGDEDQGEKELNKELRTQSKKRKRDSLLQHAMKRAATRIAPVPLGASQPPPPPVDRPKKKSERVSWLPEQEVNPVRSSRRSLAVQNKQEIHDRLKEKEKHRLKTVEVMKAAEARKEALKPKILTQEERLKEAALIEKRNSRSLNRWETNEKRRAAEQAERLAALKSRKLEGPIITYWSGQSTWVDGKLKKVGREQQPLVQEVVQEKSKTVGAEKKSDTQSMDIDQSPPGGTSTETPSTPAPTDLEPTSASPSDQLMPTTPAVQPPSEASPAENPQPVITPSLPKTGSQTDSPSSSQGMGNFLDGIHMYADLSPEQRKPSPPKPPPQAQPQATSQPTHSPSAPAKPPKPPPGPPSLATRNLIILSDFDETSTSGRGKDIDSLRSHLFGWSNATSTSSATAFSASTNGTGVGTNKKLQPVKKSLCAITGQEAKYRDPVTGLGYVDACALKRIRKVARGEMVWSGFLGAFVGEMGGRVARGVPDGFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.21
4 0.18
5 0.19
6 0.18
7 0.2
8 0.21
9 0.21
10 0.22
11 0.25
12 0.26
13 0.26
14 0.29
15 0.3
16 0.31
17 0.36
18 0.36
19 0.32
20 0.32
21 0.31
22 0.26
23 0.21
24 0.18
25 0.12
26 0.14
27 0.19
28 0.28
29 0.35
30 0.37
31 0.42
32 0.5
33 0.58
34 0.65
35 0.7
36 0.7
37 0.68
38 0.73
39 0.69
40 0.61
41 0.53
42 0.47
43 0.4
44 0.33
45 0.32
46 0.26
47 0.26
48 0.26
49 0.24
50 0.21
51 0.19
52 0.18
53 0.16
54 0.15
55 0.14
56 0.14
57 0.13
58 0.11
59 0.1
60 0.08
61 0.06
62 0.05
63 0.05
64 0.04
65 0.04
66 0.04
67 0.05
68 0.05
69 0.05
70 0.05
71 0.06
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.06
78 0.07
79 0.06
80 0.06
81 0.07
82 0.07
83 0.07
84 0.07
85 0.07
86 0.06
87 0.08
88 0.1
89 0.1
90 0.1
91 0.1
92 0.09
93 0.1
94 0.09
95 0.08
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.07
103 0.06
104 0.07
105 0.14
106 0.17
107 0.18
108 0.24
109 0.29
110 0.39
111 0.47
112 0.56
113 0.6
114 0.68
115 0.76
116 0.78
117 0.83
118 0.79
119 0.8
120 0.81
121 0.81
122 0.82
123 0.81
124 0.78
125 0.72
126 0.67
127 0.59
128 0.49
129 0.4
130 0.34
131 0.26
132 0.25
133 0.25
134 0.25
135 0.24
136 0.22
137 0.21
138 0.18
139 0.2
140 0.17
141 0.15
142 0.16
143 0.19
144 0.22
145 0.22
146 0.23
147 0.28
148 0.37
149 0.46
150 0.53
151 0.56
152 0.65
153 0.73
154 0.79
155 0.83
156 0.81
157 0.81
158 0.78
159 0.8
160 0.76
161 0.7
162 0.64
163 0.57
164 0.48
165 0.45
166 0.42
167 0.36
168 0.31
169 0.29
170 0.29
171 0.29
172 0.32
173 0.28
174 0.28
175 0.29
176 0.35
177 0.44
178 0.52
179 0.54
180 0.56
181 0.55
182 0.52
183 0.55
184 0.5
185 0.44
186 0.43
187 0.4
188 0.39
189 0.46
190 0.52
191 0.5
192 0.57
193 0.62
194 0.6
195 0.64
196 0.64
197 0.57
198 0.59
199 0.61
200 0.57
201 0.5
202 0.44
203 0.37
204 0.38
205 0.36
206 0.29
207 0.23
208 0.17
209 0.18
210 0.22
211 0.26
212 0.25
213 0.31
214 0.3
215 0.35
216 0.42
217 0.42
218 0.41
219 0.42
220 0.47
221 0.42
222 0.43
223 0.38
224 0.29
225 0.27
226 0.26
227 0.26
228 0.2
229 0.22
230 0.21
231 0.27
232 0.28
233 0.33
234 0.34
235 0.3
236 0.34
237 0.41
238 0.49
239 0.45
240 0.48
241 0.52
242 0.58
243 0.64
244 0.64
245 0.57
246 0.48
247 0.46
248 0.47
249 0.42
250 0.4
251 0.36
252 0.33
253 0.31
254 0.3
255 0.29
256 0.26
257 0.25
258 0.2
259 0.17
260 0.14
261 0.15
262 0.16
263 0.18
264 0.2
265 0.18
266 0.21
267 0.19
268 0.21
269 0.2
270 0.19
271 0.17
272 0.15
273 0.14
274 0.1
275 0.09
276 0.08
277 0.08
278 0.11
279 0.14
280 0.14
281 0.16
282 0.22
283 0.25
284 0.26
285 0.3
286 0.36
287 0.41
288 0.48
289 0.47
290 0.45
291 0.46
292 0.44
293 0.4
294 0.32
295 0.25
296 0.19
297 0.19
298 0.16
299 0.14
300 0.12
301 0.13
302 0.13
303 0.12
304 0.14
305 0.18
306 0.18
307 0.25
308 0.26
309 0.31
310 0.32
311 0.33
312 0.31
313 0.27
314 0.26
315 0.21
316 0.22
317 0.16
318 0.15
319 0.14
320 0.13
321 0.12
322 0.11
323 0.09
324 0.07
325 0.07
326 0.08
327 0.12
328 0.13
329 0.13
330 0.14
331 0.15
332 0.16
333 0.16
334 0.16
335 0.13
336 0.11
337 0.14
338 0.13
339 0.14
340 0.13
341 0.13
342 0.15
343 0.14
344 0.13
345 0.11
346 0.12
347 0.12
348 0.12
349 0.11
350 0.1
351 0.12
352 0.12
353 0.14
354 0.13
355 0.14
356 0.15
357 0.15
358 0.14
359 0.14
360 0.17
361 0.16
362 0.16
363 0.14
364 0.17
365 0.19
366 0.22
367 0.21
368 0.18
369 0.17
370 0.19
371 0.18
372 0.17
373 0.16
374 0.18
375 0.18
376 0.23
377 0.24
378 0.22
379 0.26
380 0.27
381 0.28
382 0.26
383 0.28
384 0.24
385 0.27
386 0.27
387 0.24
388 0.2
389 0.19
390 0.19
391 0.16
392 0.16
393 0.13
394 0.13
395 0.12
396 0.1
397 0.1
398 0.08
399 0.08
400 0.06
401 0.05
402 0.05
403 0.06
404 0.07
405 0.07
406 0.09
407 0.11
408 0.14
409 0.18
410 0.21
411 0.28
412 0.35
413 0.43
414 0.52
415 0.58
416 0.66
417 0.71
418 0.76
419 0.76
420 0.78
421 0.79
422 0.71
423 0.67
424 0.62
425 0.61
426 0.54
427 0.49
428 0.4
429 0.38
430 0.38
431 0.36
432 0.32
433 0.28
434 0.3
435 0.36
436 0.42
437 0.43
438 0.45
439 0.51
440 0.59
441 0.64
442 0.68
443 0.67
444 0.64
445 0.65
446 0.66
447 0.59
448 0.59
449 0.56
450 0.54
451 0.48
452 0.44
453 0.36
454 0.32
455 0.3
456 0.22
457 0.15
458 0.13
459 0.14
460 0.12
461 0.11
462 0.11
463 0.11
464 0.12
465 0.14
466 0.12
467 0.11
468 0.12
469 0.13
470 0.13
471 0.21
472 0.24
473 0.27
474 0.29
475 0.33
476 0.34
477 0.34
478 0.33
479 0.28
480 0.26
481 0.2
482 0.23
483 0.2
484 0.2
485 0.19
486 0.2
487 0.18
488 0.17
489 0.18
490 0.13
491 0.12
492 0.11
493 0.12
494 0.1
495 0.1
496 0.11
497 0.09
498 0.09
499 0.09
500 0.09
501 0.09
502 0.1
503 0.12
504 0.17
505 0.2
506 0.23
507 0.26
508 0.34
509 0.39
510 0.43
511 0.5
512 0.54
513 0.58
514 0.62
515 0.65
516 0.59
517 0.57
518 0.55
519 0.48
520 0.45
521 0.46
522 0.4
523 0.39
524 0.39
525 0.37
526 0.4
527 0.38
528 0.31
529 0.24
530 0.25
531 0.23
532 0.25
533 0.24
534 0.19
535 0.19
536 0.19
537 0.19
538 0.19
539 0.15
540 0.15
541 0.17
542 0.2
543 0.25
544 0.33
545 0.39
546 0.45
547 0.52
548 0.57
549 0.63
550 0.6
551 0.59
552 0.57
553 0.52
554 0.44
555 0.38
556 0.29
557 0.2
558 0.18
559 0.15
560 0.08
561 0.06
562 0.06
563 0.06
564 0.04
565 0.05
566 0.05
567 0.06
568 0.06
569 0.06
570 0.07
571 0.08
572 0.11