Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517LDJ0

Protein Details
Accession A0A517LDJ0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
150-172PLKSALKKTKVKQTKQVKMKVGGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MKRNPRKLGWTKSYRSAHGKEMVVDGALALASRRNVPVRYNRDHVAKALEAMVKFSEIRAKRERAFYVNRMSGNRERQLAEDRKLVAENQASYCAQIDRGNLTCFQHLLPIELRDVTLQESHIDMDESLVMDEEEMDVDMEQEEKEEVAPLKSALKKTKVKQTKQVKMKVGGGFEQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.71
3 0.64
4 0.6
5 0.58
6 0.54
7 0.45
8 0.42
9 0.36
10 0.28
11 0.24
12 0.17
13 0.1
14 0.08
15 0.06
16 0.04
17 0.06
18 0.07
19 0.08
20 0.11
21 0.15
22 0.17
23 0.23
24 0.33
25 0.39
26 0.44
27 0.48
28 0.49
29 0.51
30 0.5
31 0.46
32 0.4
33 0.32
34 0.27
35 0.25
36 0.23
37 0.18
38 0.18
39 0.17
40 0.13
41 0.13
42 0.12
43 0.17
44 0.16
45 0.23
46 0.28
47 0.32
48 0.34
49 0.4
50 0.42
51 0.41
52 0.45
53 0.43
54 0.44
55 0.43
56 0.42
57 0.38
58 0.41
59 0.4
60 0.41
61 0.39
62 0.33
63 0.3
64 0.3
65 0.38
66 0.37
67 0.34
68 0.31
69 0.29
70 0.27
71 0.27
72 0.25
73 0.19
74 0.16
75 0.15
76 0.12
77 0.14
78 0.13
79 0.12
80 0.13
81 0.1
82 0.1
83 0.1
84 0.1
85 0.11
86 0.13
87 0.14
88 0.15
89 0.16
90 0.15
91 0.14
92 0.13
93 0.14
94 0.12
95 0.13
96 0.13
97 0.13
98 0.14
99 0.13
100 0.13
101 0.1
102 0.11
103 0.1
104 0.09
105 0.08
106 0.08
107 0.08
108 0.08
109 0.09
110 0.09
111 0.07
112 0.07
113 0.07
114 0.06
115 0.06
116 0.06
117 0.05
118 0.05
119 0.05
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.05
127 0.05
128 0.05
129 0.05
130 0.06
131 0.05
132 0.06
133 0.09
134 0.1
135 0.1
136 0.11
137 0.11
138 0.18
139 0.22
140 0.28
141 0.33
142 0.4
143 0.48
144 0.54
145 0.64
146 0.68
147 0.71
148 0.75
149 0.79
150 0.81
151 0.82
152 0.85
153 0.82
154 0.78
155 0.78
156 0.71
157 0.64