Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A517LGS9

Protein Details
Accession A0A517LGS9    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
97-126LGVKVEKASRQQRKQRKNRAKEFRGTAKTKHydrophilic
NLS Segment(s)
PositionSequence
103-134KASRQQRKQRKNRAKEFRGTAKTKGSKKKAKD
Subcellular Location(s) mito 16, cyto 7, cyto_nucl 6.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSDAPVTLRTRKFIRNPLLGRKQMVVDVLHPNRPNVSKDELRTKLSEMYKANKDAVSVFGFRTQYGGGKSTGFALVYDSPEALKKFEPNYRLVRYSLGVKVEKASRQQRKQRKNRAKEFRGTAKTKGSKKKAKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.67
4 0.72
5 0.77
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.22
14 0.29
15 0.29
16 0.33
17 0.32
18 0.32
19 0.33
20 0.34
21 0.33
22 0.28
23 0.32
24 0.31
25 0.34
26 0.43
27 0.43
28 0.43
29 0.42
30 0.4
31 0.4
32 0.36
33 0.38
34 0.31
35 0.34
36 0.35
37 0.36
38 0.35
39 0.29
40 0.27
41 0.22
42 0.22
43 0.18
44 0.15
45 0.13
46 0.15
47 0.15
48 0.14
49 0.15
50 0.12
51 0.12
52 0.12
53 0.13
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.07
61 0.08
62 0.09
63 0.09
64 0.09
65 0.08
66 0.08
67 0.11
68 0.11
69 0.1
70 0.1
71 0.13
72 0.16
73 0.21
74 0.23
75 0.26
76 0.33
77 0.36
78 0.37
79 0.35
80 0.33
81 0.3
82 0.32
83 0.3
84 0.27
85 0.24
86 0.22
87 0.25
88 0.27
89 0.29
90 0.33
91 0.41
92 0.46
93 0.55
94 0.65
95 0.73
96 0.8
97 0.87
98 0.9
99 0.91
100 0.92
101 0.93
102 0.94
103 0.91
104 0.89
105 0.87
106 0.86
107 0.84
108 0.77
109 0.72
110 0.71
111 0.71
112 0.71
113 0.73
114 0.73