Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A517LK94

Protein Details
Accession A0A517LK94    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-33SIGTATKKKRSTPSRRVFPFMKHydrophilic
74-97LGNLSKANRRRRLKTYHRNPVKYYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MSMDKPKKDSASIGTATKKKRSTPSRRVFPFMKLPAEIRLKIFGLCLVSEDLMSLYETYGSLMSKRTGQLKPELGNLSKANRRRRLKTYHRNPVKYYRNGPLNEMAVQILQLNHQIYNEALPVLYNQPLEFYTTEALDLFFACTNTAMPPMLRNITIRRTHLSQDTPQQLSYNQAYLRFDKLSLAVNIQKFSINQLIVSDYDFIDEQSTAKGAELFIEVAQHWLAMIRNREKGETNWKKVVHVESFLCCERYCICRLSPVCPVPPREPVDFMATLEKHLAVRGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.53
4 0.57
5 0.55
6 0.55
7 0.62
8 0.67
9 0.7
10 0.74
11 0.8
12 0.82
13 0.83
14 0.83
15 0.76
16 0.71
17 0.7
18 0.65
19 0.58
20 0.49
21 0.45
22 0.46
23 0.49
24 0.44
25 0.36
26 0.34
27 0.31
28 0.29
29 0.28
30 0.22
31 0.17
32 0.15
33 0.15
34 0.13
35 0.12
36 0.11
37 0.11
38 0.09
39 0.08
40 0.09
41 0.07
42 0.06
43 0.06
44 0.06
45 0.07
46 0.07
47 0.07
48 0.07
49 0.09
50 0.11
51 0.13
52 0.16
53 0.23
54 0.25
55 0.28
56 0.34
57 0.38
58 0.38
59 0.41
60 0.42
61 0.36
62 0.38
63 0.37
64 0.35
65 0.36
66 0.41
67 0.45
68 0.51
69 0.57
70 0.6
71 0.66
72 0.71
73 0.76
74 0.8
75 0.81
76 0.83
77 0.85
78 0.83
79 0.8
80 0.8
81 0.78
82 0.73
83 0.67
84 0.63
85 0.61
86 0.56
87 0.54
88 0.48
89 0.4
90 0.34
91 0.29
92 0.22
93 0.14
94 0.14
95 0.12
96 0.08
97 0.07
98 0.08
99 0.08
100 0.08
101 0.08
102 0.09
103 0.08
104 0.09
105 0.09
106 0.06
107 0.05
108 0.05
109 0.06
110 0.07
111 0.08
112 0.08
113 0.07
114 0.08
115 0.08
116 0.1
117 0.1
118 0.09
119 0.08
120 0.08
121 0.09
122 0.08
123 0.08
124 0.06
125 0.06
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.06
133 0.06
134 0.06
135 0.05
136 0.06
137 0.08
138 0.09
139 0.09
140 0.11
141 0.13
142 0.2
143 0.23
144 0.24
145 0.25
146 0.27
147 0.28
148 0.31
149 0.32
150 0.28
151 0.32
152 0.36
153 0.34
154 0.32
155 0.3
156 0.26
157 0.26
158 0.24
159 0.2
160 0.15
161 0.16
162 0.18
163 0.19
164 0.22
165 0.19
166 0.18
167 0.15
168 0.16
169 0.17
170 0.16
171 0.17
172 0.18
173 0.19
174 0.19
175 0.19
176 0.19
177 0.16
178 0.18
179 0.19
180 0.15
181 0.13
182 0.14
183 0.14
184 0.14
185 0.15
186 0.13
187 0.08
188 0.09
189 0.09
190 0.08
191 0.08
192 0.08
193 0.08
194 0.07
195 0.08
196 0.07
197 0.07
198 0.08
199 0.06
200 0.07
201 0.08
202 0.08
203 0.08
204 0.09
205 0.08
206 0.09
207 0.09
208 0.08
209 0.06
210 0.07
211 0.09
212 0.13
213 0.2
214 0.24
215 0.3
216 0.31
217 0.34
218 0.35
219 0.38
220 0.45
221 0.48
222 0.5
223 0.52
224 0.52
225 0.51
226 0.53
227 0.55
228 0.47
229 0.42
230 0.38
231 0.33
232 0.37
233 0.37
234 0.34
235 0.27
236 0.26
237 0.24
238 0.25
239 0.26
240 0.24
241 0.23
242 0.31
243 0.33
244 0.36
245 0.42
246 0.43
247 0.47
248 0.5
249 0.55
250 0.5
251 0.57
252 0.57
253 0.51
254 0.5
255 0.44
256 0.45
257 0.4
258 0.36
259 0.36
260 0.32
261 0.3
262 0.28
263 0.26
264 0.2