Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LJL5

Protein Details
Accession E2LJL5   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MSSPPALIRRRPNHRRLSTPSRPPRRHHRLSFCQPLPPHydrophilic
NLS Segment(s)
PositionSequence
9-27RRRPNHRRLSTPSRPPRRH
Subcellular Location(s) nucl 17, cyto_nucl 12.5, cyto 6, mito 4
Family & Domain DBs
KEGG mpr:MPER_06808  -  
Amino Acid Sequences MSSPPALIRRRPNHRRLSTPSRPPRRHHRLSFCQPLPPSLEALDLSSASPTQTLASLRFLVLSYLAEIELRLSHIKGEEHSELHITDQSNTIEDVRVWARTTLDMLDSIRADVCSHLPEFGLPDITVEKLRSHLPYLSEVPSITSHLPDFDFDFDDFDFRNKLDDVRTRFNDFDFHQPLEFIPTLSARLQTLHSHMFAIELPQLGQTGSGTLYFLHFVLSDLVDSLLSSEASHRHPSISHRIRCLKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.84
4 0.84
5 0.83
6 0.84
7 0.85
8 0.86
9 0.85
10 0.83
11 0.85
12 0.85
13 0.85
14 0.85
15 0.84
16 0.84
17 0.86
18 0.9
19 0.8
20 0.77
21 0.68
22 0.6
23 0.54
24 0.45
25 0.37
26 0.26
27 0.26
28 0.19
29 0.19
30 0.17
31 0.12
32 0.11
33 0.1
34 0.1
35 0.08
36 0.08
37 0.07
38 0.06
39 0.08
40 0.1
41 0.11
42 0.13
43 0.14
44 0.14
45 0.14
46 0.14
47 0.12
48 0.11
49 0.1
50 0.07
51 0.07
52 0.07
53 0.06
54 0.06
55 0.06
56 0.06
57 0.08
58 0.08
59 0.07
60 0.08
61 0.1
62 0.11
63 0.12
64 0.17
65 0.17
66 0.16
67 0.17
68 0.17
69 0.16
70 0.16
71 0.18
72 0.13
73 0.12
74 0.14
75 0.14
76 0.13
77 0.13
78 0.13
79 0.11
80 0.1
81 0.12
82 0.1
83 0.11
84 0.11
85 0.11
86 0.11
87 0.11
88 0.12
89 0.09
90 0.09
91 0.09
92 0.08
93 0.09
94 0.09
95 0.09
96 0.08
97 0.08
98 0.07
99 0.07
100 0.07
101 0.08
102 0.08
103 0.08
104 0.07
105 0.07
106 0.08
107 0.08
108 0.08
109 0.06
110 0.06
111 0.06
112 0.07
113 0.08
114 0.08
115 0.08
116 0.08
117 0.1
118 0.11
119 0.12
120 0.13
121 0.14
122 0.16
123 0.19
124 0.19
125 0.18
126 0.16
127 0.16
128 0.15
129 0.16
130 0.12
131 0.11
132 0.09
133 0.1
134 0.1
135 0.09
136 0.1
137 0.09
138 0.11
139 0.1
140 0.11
141 0.1
142 0.11
143 0.11
144 0.11
145 0.1
146 0.08
147 0.1
148 0.1
149 0.11
150 0.15
151 0.22
152 0.27
153 0.34
154 0.38
155 0.4
156 0.4
157 0.39
158 0.38
159 0.33
160 0.36
161 0.32
162 0.3
163 0.26
164 0.26
165 0.25
166 0.26
167 0.24
168 0.15
169 0.12
170 0.12
171 0.14
172 0.14
173 0.15
174 0.11
175 0.12
176 0.14
177 0.15
178 0.18
179 0.19
180 0.19
181 0.18
182 0.18
183 0.17
184 0.15
185 0.15
186 0.13
187 0.1
188 0.1
189 0.1
190 0.1
191 0.09
192 0.09
193 0.07
194 0.06
195 0.07
196 0.07
197 0.06
198 0.07
199 0.08
200 0.08
201 0.08
202 0.08
203 0.07
204 0.08
205 0.1
206 0.1
207 0.09
208 0.09
209 0.09
210 0.08
211 0.08
212 0.08
213 0.07
214 0.07
215 0.07
216 0.09
217 0.12
218 0.17
219 0.22
220 0.22
221 0.22
222 0.25
223 0.31
224 0.41
225 0.47
226 0.5
227 0.54